TkA02G594120 | RubberDandelionOmics

Gene overview

TkA02G594120

Reference: TK1151 Chr: Chr02 Coordinates: 153285965-153291322 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2107 bp · TkA02G594120|TK1151|cDNA

AAAAAGCTAAATCGGCTGCTAATCATTAAATCCCAAAATTATAGTCAACATCTTTTGTAGAACGGCATAAACAACAACTAGAAAAACTAAAATGTTTGTCTTACAAGAAAGAAGTAAATTAAATTATGACAAGGAAAAAAGTCATTTAATATTCATATTCAGTGACATTTGATAGTAATATTTTGAGAACCAAAATATGATTCATAAATCATAACCATTTGAGAGCATAATATATGATTGTTATATCATAACCCGTGACT...

CDS

Download CDS FASTA

1461 bp · TkA02G594120|TK1151|CDS

ATGGCCAACCTTTACCACCTTCTACTTCTTTCTCTCATTCTGATATCCAATTTTGCTCCCACATTTCAAACCCACCTCGCAACCACACCACCATTGCCGGTGTTACCCCTCCCTTCATACTCCCAACTCAAATGGCAAAAACGAGAAATCATCTTCTTCCACCATTTCGGTGTCAACACGTTTACAGATTCAGAATGGGGGACCGGAAAAGAAAACCCCAAAATTTTCAATCCCAAGGGGCTTAACACCGCCCAGTGGGT...

Protein

Download Protein FASTA

486 aa · TkA02G594120|TK1151|PROTEIN

MANLYHLLLLSLILISNFAPTFQTHLATTPPLPVLPLPSYSQLKWQKREIIFFHHFGVNTFTDSEWGTGKENPKIFNPKGLNTAQWVDVAVQTGVSLSILTAKHHDGFCLWPSKYTDHSVIGSPWKDGNGDVLEEFTKSAKSRGVDVGLYLSPWDRHDRRYGDILAYNEYYLAQLQELLNKYGSVNEIWFDGAKGSNAPNMSYFFDDWFQMVSELQGTINIFSDAGPGVRWVGNENGFAGTTCWSTINQTSLSIGNESIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G594120`
TK1151 ID	TkA02G594120
OH-1004 ID	LXL04_011998
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G594120

Location Chr02:153285965-153291322 (-)

Description Similar to FUC1: Alpha-L-fucosidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28100`	Hydrolyzes both 3- and 4-linked fucoses in Lewis determinants.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0560400`	Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011998 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0006516 glycoprotein catabolic process Biological Process

GO:0009617 response to bacterium Biological Process

GO:0016139 glycoside catabolic process Biological Process

GO:2000535 regulation of entry of bacterium into host cell Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0035578 azurophil granule lumen Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT2G28100

hsa:2519

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.210

Rank 1 · TkA02G594120 · TK1151

Cytoplasm0.166

Rank 2 · TkA02G594120 · TK1151

Lysosome / Vacuole0.136

Rank 3 · TkA02G594120 · TK1151

Endoplasmic reticulum0.106

Rank 4 · TkA02G594120 · TK1151

Peroxisome0.102

Rank 5 · TkA02G594120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27145YfhS39-55 aa

PF01120Alpha_L_fucos71-337 aa

PF27145YfhS165-184 aa

PF28976RRM_ACIN1171-194 aa

PF24685OB_RRP5_4th407-467 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G594120	`PF27145`	YfhS	39	55	0.23	12.2
TkA02G594120	`PF01120`	Alpha_L_fucos	71	337	6.7e-31	108.7
TkA02G594120	`PF27145`	YfhS	165	184	0.23	12.2
TkA02G594120	`PF28976`	RRM_ACIN1	171	194	0.06	14.2
TkA02G594120	`PF24685`	OB_RRP5_4th	407	467	0.27	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GW72`	Arabidopsis thaliana	sp\|Q8GW72\|FUCO1_ARATH Alpha-L-fucosidase 1	53.300%	Swiss-Prot	High
`Q7XUR3`	Oryza sativa subsp. japonica	sp\|Q7XUR3\|FUCO1_ORYSJ Putative alpha-L-fucosidase 1	51.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card