TkA02G550850 | RubberDandelionOmics

Gene overview

TkA02G550850

Reference: TK1151 Chr: Chr02 Coordinates: 142129896-142132390 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2292 bp · TkA02G550850|TK1151|cDNA

CTTGTACATAACGAGATCATCTTTCCTCAAGGTTCGCCAAGTATCCCCCATATAGCGGGAAAAAGGTTACATGGTGCATAGATTTGGAAATGAAATTTAGCGTATACACACAATTGGCTGCCGCTATCGATCAGCCCCATATCAATCGGCAAATCCGCATAACTCTCTTTCTCTATCTCCGGAAACATTTCTCTCAAATAAAATTTCAATTTTCTTCACGGAGATCCGGGTACGTAACGTTAGTTTAGATCAATCGAACG...

CDS

Download CDS FASTA

1467 bp · TkA02G550850|TK1151|CDS

ATGGCGGCATCACGGCGTCTCCGTGACCTACAATCGCAGCCAGGCAACAAGACCTGCGTCGATTGTTCACAAAAGAACCCTCAGTGGGCCTCCGTATCCTATGGCATTTTTATGTGCTTAGAATGCTCCGGCAAGCACCGCGGCCTCGGTGTCCACATCTCCTTTGTCCGATCGGTCACCATGGATTCATGGTCCGAGATCCAGCTCCGTAAAATGGACGCCGGCGGCAACGAGAACTTAAACAGTTTTTTGTCTCAGTA...

Protein

Download Protein FASTA

488 aa · TkA02G550850|TK1151|PROTEIN

MAASRRLRDLQSQPGNKTCVDCSQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQLRKMDAGGNENLNSFLSQYGIPKETDITAKYNSNGASVYRDRIQALAEGKQWRDPPVVKESPIKGGSKKKPPMPGGGGGGARVSNNQGNGGWDDHWGDNSFDDDAYRSPDNMRRNQTVGDFRSGSGGSGAPSRSRSTQNLYTQSQYDASAASKEEFFARRMAENETRPEGLPPSQGGKYVGFGSSPNNMPRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G550850`
TK1151 ID	TkA02G550850
OH-1004 ID	LXL04_032747
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.900
Protein coverage (%)	TK1151 99.795 / OH-1004 99.786 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G550850

Location Chr02:142129896-142132390 (+)

Description Similar to AGD7: ADP-ribosylation factor GTPase-activating protein AGD7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37550`	GTPase-activating protein (GAP) for ADP ribosylation factor (ARF).	Overexpression of Arabidopsis AGD7 causes relocation of Golgi-localized proteins to the endoplasmic reticulum and inhibits protein trafficking in plant cells.2007 · DOI: 10.1104/pp.106.095091
`At3g53710`	GTPase-activating protein (GAP) for ADP ribosylation factor (ARF).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032747 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0007015 actin filament organization Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0030100 regulation of endocytosis Biological Process

GO:0032012 regulation of ARF protein signal transduction Biological Process

GO:0043001 Golgi to plasma membrane protein transport Biological Process

GO:0048205 COPI coating of Golgi vesicle Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G37550

ath:AT3G53710

hsa:55738

mmu:228998

sce:YDL226C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.524

Rank 1 · TkA02G550850 · TK1151

Cytoplasm0.418

Rank 2 · TkA02G550850 · TK1151

Endoplasmic reticulum0.148

Rank 3 · TkA02G550850 · TK1151

Cell membrane0.119

Rank 4 · TkA02G550850 · TK1151

Nucleus0.098

Rank 5 · TkA02G550850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01412ArfGap5-110 aa

PF13842zf-Tnp_213-43 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G550850	`PF01412`	ArfGap	5	110	1.8e-35	122.3
TkA02G550850	`PF13842`	zf-Tnp_2	13	43	0.049	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80925`	Arabidopsis thaliana	sp\|O80925\|AGD7_ARATH ADP-ribosylation factor GTPase-activating protein AGD7	69.200%	Swiss-Prot	High
`Q9M354`	Arabidopsis thaliana	sp\|Q9M354\|AGD6_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD6	56.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card