TkA02G497890 | RubberDandelionOmics

Gene overview

TkA02G497890

Reference: TK1151 Chr: Chr02 Coordinates: 127481020-127482447 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1428 bp · TkA02G497890|TK1151|cDNA

ATGTCCGAGGTCGACCTCCTCCGTTCTGATAAGAAGAAAAAGAAGAGCAAGTCCAAAGATACCGAAGCAACTACTGAAGTAGCAGATGACGCCACCGCTCCCGCCGATTACTTAATCAAACCACAGAGCTTCACACCAGCCATCGACACTTCTGAATGGCCGATTCTTCTTAAGAACTACGACCGACTCAATGTACGAACCGGACACTACACTCCTCTTCCATCCGGTTACTCCCCTCTTAAGCGTCCTCTCGCTGAATA...

CDS

Download CDS FASTA

1428 bp · TkA02G497890|TK1151|CDS

ATGTCCGAGGTCGACCTCCTCCGTTCTGATAAGAAGAAAAAGAAGAGCAAGTCCAAAGATACCGAAGCAACTACTGAAGTAGCAGATGACGCCACCGCTCCCGCCGATTACTTAATCAAACCACAGAGCTTCACACCAGCCATCGACACTTCTGAATGGCCGATTCTTCTTAAGAACTACGACCGACTCAATGTACGAACCGGACACTACACTCCTCTTCCATCCGGTTACTCCCCTCTTAAGCGTCCTCTCGCTGAATA...

Protein

Download Protein FASTA

475 aa · TkA02G497890|TK1151|PROTEIN

MSEVDLLRSDKKKKKSKSKDTEATTEVADDATAPADYLIKPQSFTPAIDTSEWPILLKNYDRLNVRTGHYTPLPSGYSPLKRPLAEYIRYGVINLDKPANPSSHEVVAWIKRILRVEKTGHSGTLDPKVTGNLIVCIDRATRLVKSQQGAGKEYVCVARLHSDVPDVAKVARALETLTGAVFQRPPLISAVKRQLRIRTIYESKLLEYDAEKHLVVFWISCEAGTYVRTLCVHLGLILGVGGHMQELRRVRSGIMGEKDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G497890`
TK1151 ID	TkA02G497890
OH-1004 ID	LXL04_006094
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	30.200
Protein coverage (%)	TK1151 37.684 / OH-1004 37.828 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G497890

Location Chr02:127481020-127482447 (+)

Description Similar to truB: tRNA pseudouridine synthase B (Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57150`	Plays a central role in ribosomal RNA processing.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006094 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031119 tRNA pseudouridine synthesis Biological Process

GO:1990481 mRNA pseudouridine synthesis Biological Process

GO:0003723 RNA binding Molecular Function

GO:0160148 tRNA pseudouridine(55) synthase activity Molecular Function

KEGG gene cross-reference

aau:AAur_1565

art:Arth_1424

cpe:CPE1683

fjo:Fjoh_0570

tfu:Tfu_0781

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.772

Rank 1 · TkA02G497890 · TK1151

Cytoplasm0.255

Rank 2 · TkA02G497890 · TK1151

Mitochondrion0.049

Rank 3 · TkA02G497890 · TK1151

Cell membrane0.021

Rank 4 · TkA02G497890 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA02G497890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12300RhlB14-36 aa

PF08068DKCLD50-107 aa

PF01509TruB_N111-227 aa

PF12300RhlB128-150 aa

PF21238Pus10_C133-230 aa

PF16198TruB_C_2228-294 aa

PF03657UPF0113235-252 aa

PF08068DKCLD290-314 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G497890	`PF12300`	RhlB	14	36	0.92	10.7
TkA02G497890	`PF08068`	DKCLD	50	107	6.5e-34	116.5
TkA02G497890	`PF01509`	TruB_N	111	227	2e-23	84.2
TkA02G497890	`PF12300`	RhlB	128	150	0.92	10.7
TkA02G497890	`PF21238`	Pus10_C	133	230	0.0086	16.3
TkA02G497890	`PF16198`	TruB_C_2	228	294	3.7e-26	91.8
TkA02G497890	`PF03657`	UPF0113	235	252	0.036	15.1
TkA02G497890	`PF08068`	DKCLD	290	314	6.5e-34	116.5
TkA02G497890	`PF01472`	PUA	298	371	2.6e-22	79.2
TkA02G497890	`PF03657`	UPF0113	300	362	0.036	15.1
TkA02G497890	`PF26292`	PUA_elF2D	304	366	0.0011	19.5
TkA02G497890	`PF26292`	PUA_elF2D	419	439	0.0011	19.5
TkA02G497890	`PF12300`	RhlB	425	461	0.92	10.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD90`	Arabidopsis thaliana	sp\|Q9LD90\|CBF5_ARATH H/ACA ribonucleoprotein complex subunit 4	82.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card