TkA02G292200 | RubberDandelionOmics

Gene overview

TkA02G292200

Reference: TK1151 Chr: Chr02 Coordinates: 74591381-74593363 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · TkA02G292200|TK1151|cDNA

ATGGGAGTTAAAGGTCTCTGGGATATACTAGATTCTTGCAAGAAAACCCTCCTTCTCCACCATCTGCAGAACAAGACGGTGTGCGTAGATCTATCATGTTGGATAGTTCAACTTAACAAAGTAAACCAATCACACTGTGCTCTGAAAGATAAGCTTTATCTCAAGGGTTTATTTCATCGCATCAGGGCTCTCATTGCGTTAAATTGTAGCCTCATCTTCGTCACAGATGGATCGATTCCAGGTATCAAAGTAACTACATA...

CDS

Download CDS FASTA

1002 bp · TkA02G292200|TK1151|CDS

ATGGGAGTTAAAGGTCTCTGGGATATACTAGATTCTTGCAAGAAAACCCTCCTTCTCCACCATCTGCAGAACAAGACGGTGTGCGTAGATCTATCATGTTGGATAGTTCAACTTAACAAAGTAAACCAATCACACTGTGCTCTGAAAGATAAGCTTTATCTCAAGGGTTTATTTCATCGCATCAGGGCTCTCATTGCGTTAAATTGTAGCCTCATCTTCGTCACAGATGGATCGATTCCAGGTATCAAAGTAACTACATA...

Protein

Download Protein FASTA

333 aa · TkA02G292200|TK1151|PROTEIN

MGVKGLWDILDSCKKTLLLHHLQNKTVCVDLSCWIVQLNKVNQSHCALKDKLYLKGLFHRIRALIALNCSLIFVTDGSIPGIKVTTYRQRLHLDNEGRDESYLNKTIPLQRNTGSEFSCMIKEAKILASALGVPCLDGIEEGEAQCALLDAESLCDGCFSLDSDIVLFGARTVYRDICLGEGGYVVCYEMDDIEKKLGLGRKSLIALAVRLGCDYAPGVPRLGANLACKIVKSFSESEVLQRIASEDLSVLKKTNRSKKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G292200`
TK1151 ID	TkA02G292200
OH-1004 ID	LXL04_006736
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 75.676 / OH-1004 81.494 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G292200

Location Chr02:74591381-74593363 (-)

Description Similar to SEND1: Single-strand DNA endonuclease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9M2Z3`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA with a specific cleavage site in the 5' overhang strand exactly one nucleotide 3' of the branch point.	No verified direct reference in this release
`At1g01880`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA with a specific cleavage site in the 5' overhang strand exactly one nucleotide 3' of the branch point.	AtGEN1 and AtSEND1, two paralogs in Arabidopsis, possess holliday junction resolvase activity.2014 · DOI: 10.1104/pp.114.237834
`At3g28030`	Putative single-stranded DNA endonuclease involved in nucleotide excision repair (NER) of UV- and oxidative damaged DNA.	Arabidopsis UVH3 gene is a homolog of the Saccharomyces cerevisiae RAD2 and human XPG DNA repair genes.2001 · DOI: 10.1046/j.1365-313x.2001.01031.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0101600`	Single-stranded DNA endonuclease activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006736 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0009408 response to heat Biological Process

GO:0009650 UV protection Biological Process

GO:0010213 non-photoreactive DNA repair Biological Process

GO:0010824 regulation of centrosome duplication Biological Process

GO:0031297 replication fork processing Biological Process

GO:0071139 resolution of DNA recombination intermediates Biological Process

GO:0071140 resolution of mitotic recombination intermediates Biological Process

GO:0090267 positive regulation of mitotic cell cycle spindle assembly checkpoint Biological Process

KEGG gene cross-reference

ath:AT3G48900

dosa:Os08g0101600

hsa:348654

mmu:209334

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.792

Rank 1 · TkA02G292200 · TK1151

Cytoplasm0.229

Rank 2 · TkA02G292200 · TK1151

Mitochondrion0.055

Rank 3 · TkA02G292200 · TK1151

Cell membrane0.033

Rank 4 · TkA02G292200 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA02G292200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00752XPG_N1-90 aa

PF00867XPG_I132-214 aa

PF00867XPG_I251-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G292200	`PF00752`	XPG_N	1	90	2.4e-13	51.1
TkA02G292200	`PF00867`	XPG_I	132	214	6.4e-19	68.8
TkA02G292200	`PF00867`	XPG_I	251	255	6.4e-19	68.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2Z3`	Arabidopsis thaliana	sp\|Q9M2Z3\|GENL2_ARATH Single-strand DNA endonuclease 1	58.800%	Swiss-Prot	High
`Q9LPD2`	Arabidopsis thaliana	sp\|Q9LPD2\|GENL1_ARATH Flap endonuclease GEN-like 1	36.300%	Swiss-Prot	Medium
`Q9ATY5`	Arabidopsis thaliana	sp\|Q9ATY5\|UVH3_ARATH DNA repair protein UVH3	40.700%	Swiss-Prot	Low
`Q8W5R1`	Oryza sativa subsp. japonica	sp\|Q8W5R1\|GENL2_ORYSJ Single-strand DNA endonuclease 1	56.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card