LXL04_006736 | RubberDandelionOmics

Gene overview

LXL04_006736

Reference: OH-1004 Chr: Chr02 Coordinates: 23614003-23615863 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · LXL04_006736|LXL04_006736|OH1004|cDNA

ATGTGTACTAATCACTGGGTGATTGATTTGTTTCTTTTTGTGGGAAATCGATCAGAGGGTGATTTCAGCTTTGCTCGATGGCAAGAAAACCCTCCCTCTCCACCATCTCCAAACAAGACGGTGTGCGTAGATCTATCATGTTGGATGGTTCAACTTAACAAAGTAAACCAATCACACTGTGCACTGAAAGATAAGCTTTATCTCAAGGGTTTATTTCATCGCATCAGGGCTCTCATTGCGTTAAATTGTAGCCTCATCTT...

CDS

Download CDS FASTA

927 bp · LXL04_006736|LXL04_006736|OH1004|CDS

ATGTGTACTAATCACTGGGTGATTGATTTGTTTCTTTTTGTGGGAAATCGATCAGAGGGTGATTTCAGCTTTGCTCGATGGCAAGAAAACCCTCCCTCTCCACCATCTCCAAACAAGACGGTGTGCGTAGATCTATCATGTTGGATGGTTCAACTTAACAAAGTAAACCAATCACACTGTGCACTGAAAGATAAGCTTTATCTCAAGGGTTTATTTCATCGCATCAGGGCTCTCATTGCGTTAAATTGTAGCCTCATCTT...

Protein

Download Protein FASTA

308 aa · LXL04_006736|LXL04_006736|OH1004|PROTEIN

MCTNHWVIDLFLFVGNRSEGDFSFARWQENPPSPPSPNKTVCVDLSCWMVQLNKVNQSHCALKDKLYLKGLFHRIRALIALNCSLIFVTDGSIPGIKVTTYRQRLHLDNEGRDESYLNKTIPLQRNMGSKFSCMIKEAKILASALGVPCLDGIEEGEAQCALLDSESLCDGCFSLDSDIFLFGARTVYRDICLGEGGYVVCYEMDDIEKKLGLGRNSLIALAVLLGCDYAPGVPRLGANLACKIVKSFSESEVLQRIASE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006736`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006736

Location Chr02:23614003-23615863 (-)

Description Similar to SEND1: Single-strand DNA endonuclease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9M2Z3`	Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA with a specific cleavage site in the 5' overhang strand exactly one nucleotide 3' of the branch point.	No verified direct reference in this release
`At3g28030`	Putative single-stranded DNA endonuclease involved in nucleotide excision repair (NER) of UV- and oxidative damaged DNA.	Arabidopsis UVH3 gene is a homolog of the Saccharomyces cerevisiae RAD2 and human XPG DNA repair genes.2001 · DOI: 10.1046/j.1365-313x.2001.01031.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0101600`	Single-stranded DNA endonuclease activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006736 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0009408 response to heat Biological Process

GO:0009650 UV protection Biological Process

GO:0010213 non-photoreactive DNA repair Biological Process

GO:0010824 regulation of centrosome duplication Biological Process

GO:0031297 replication fork processing Biological Process

GO:0071139 resolution of DNA recombination intermediates Biological Process

GO:0071140 resolution of mitotic recombination intermediates Biological Process

GO:0090267 positive regulation of mitotic cell cycle spindle assembly checkpoint Biological Process

KEGG gene cross-reference

ath:AT3G48900

dosa:Os08g0101600

hsa:348654

mmu:209334

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.632

Rank 1 · LXL04_006736 · OH-1004

Cytoplasm0.321

Rank 2 · LXL04_006736 · OH-1004

Mitochondrion0.063

Rank 3 · LXL04_006736 · OH-1004

Cell membrane0.044

Rank 4 · LXL04_006736 · OH-1004

Endoplasmic reticulum0.038

Rank 5 · LXL04_006736 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00752.24XPG_N38-104 aa

PF00867.24XPG_I146-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006736	`PF00752.24`	XPG_N	38	104	7.1e-06	27.1
LXL04_006736	`PF00867.24`	XPG_I	146	228	9.2e-21	74.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2Z3`	Arabidopsis thaliana	Single-strand DNA endonuclease 1	67.227%	Swiss-Prot	strong database homology
`Q9ATY5`	Arabidopsis thaliana	DNA repair protein UVH3	42.384%	Swiss-Prot	weak database homology
`Q8W5R1`	Oryza sativa subsp. japonica	Single-strand DNA endonuclease 1	62.393%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card