TkA02G290150 | RubberDandelionOmics

Gene overview

TkA02G290150

Reference: TK1151 Chr: Chr02 Coordinates: 74129705-74135779 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4109 bp · TkA02G290150|TK1151|cDNA

ATGTGCTACTGTGCTAGTGTGTGCGGCGGGTGAACCCGCTCAGTTATTCCTGTTCGACGCAACCAAGATAAACCGAAGGAAACTCTCTCGCTATCTCGTTCATCACAGCGTCACCATCACTTGCAGGCTAAGCTTGCACCTGCCGCAAGCATAATCTAGTAAGCCCTAGTTCTACCACAAGTGTGGCGTTAAGAAGCCTTCTTTCTCTACATCCAATTCGCCTTATCCGCAACCTTCAATCATCCATCGTACACCGGAGT...

CDS

Download CDS FASTA

3285 bp · TkA02G290150|TK1151|CDS

ATGGCAGACGCCAATGACAGTGGTAGAAGCTTCAAGAGGAGGGACCAGCTTCTGGAAATGGAACACGAAGTCCGAAAATGGTGGGATGATGGCCAAGTTTTCAATGCTGAAGCCAGTGATCAACCTCCCAAAGAAGGCGACAAGTTTTTTGGGAGCTTCCCATTTCCATATATGAACGGATATCTCCATCTAGGGCACGCATTTTCCCTCTCCAAACTCGAATTCGCTGCTGCATATCACAGATTAAGGGGCGCTAACGT...

Protein

Download Protein FASTA

1094 aa · TkA02G290150|TK1151|PROTEIN

MADANDSGRSFKRRDQLLEMEHEVRKWWDDGQVFNAEASDQPPKEGDKFFGSFPFPYMNGYLHLGHAFSLSKLEFAAAYHRLRGANVLLPFGFHCTGMPIKASADKLRREIERFGNPPSFPSETEETVIEPEVKIEGSQQSQPDKFKGKKSKAASKTGKETYQWEIMRGYGLSDTEIATFQDPVQWLRFFPPLAVEDLKAFGLGADWRRSFITTDINPYFDSFVRWQMRKLKSMGKIVKDLRYTIYSPLDGQPCADHDRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G290150`
TK1151 ID	TkA02G290150
OH-1004 ID	LXL04_003357
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.000
Protein coverage (%)	TK1151 9.598 / OH-1004 22.440 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G290150

Location Chr02:74129705-74135779 (-)

Description Similar to At1g09620: Leucine--tRNA ligase, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09620`	Catalyzes the specific attachment of an amino acid to its cognate tRNA in a two step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003357 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006425 glutaminyl-tRNA aminoacylation Biological Process

GO:0006429 leucyl-tRNA aminoacylation Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0032008 positive regulation of TOR signaling Biological Process

GO:0034198 cellular response to amino acid starvation Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0071230 cellular response to amino acid stimulus Biological Process

GO:0071233 cellular response to L-leucine Biological Process

GO:1904263 positive regulation of TORC1 signaling Biological Process

KEGG gene cross-reference

ath:AT1G09620

cel:CELE_R74.1

hsa:51520

mmu:107045

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624

Rank 1 · TkA02G290150 · TK1151

Nucleus0.204

Rank 2 · TkA02G290150 · TK1151

Mitochondrion0.124

Rank 3 · TkA02G290150 · TK1151

Peroxisome0.113

Rank 4 · TkA02G290150 · TK1151

Plastid0.076

Rank 5 · TkA02G290150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00133tRNA-synt_125-106 aa

PF09334tRNA-synt_1g54-111 aa

PF28879CCDC163125-142 aa

PF00133tRNA-synt_1196-759 aa

PF28879CCDC163343-366 aa

PF09334tRNA-synt_1g565-592 aa

PF09334tRNA-synt_1g665-765 aa

PF01406tRNA-synt_1e674-749 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G290150	`PF00133`	tRNA-synt_1	25	106	4.2e-26	92.4
TkA02G290150	`PF09334`	tRNA-synt_1g	54	111	3.8e-15	56.3
TkA02G290150	`PF28879`	CCDC163	125	142	0.44	11.6
TkA02G290150	`PF00133`	tRNA-synt_1	196	759	4.2e-26	92.4
TkA02G290150	`PF28879`	CCDC163	343	366	0.44	11.6
TkA02G290150	`PF09334`	tRNA-synt_1g	565	592	3.8e-15	56.3
TkA02G290150	`PF09334`	tRNA-synt_1g	665	765	3.8e-15	56.3
TkA02G290150	`PF01406`	tRNA-synt_1e	674	749	4.4e-08	33.6
TkA02G290150	`PF01921`	tRNA-synt_1f	675	749	0.14	11.8
TkA02G290150	`PF08264`	Anticodon_1	732	780	2.6e-16	60.6
TkA02G290150	`PF08264`	Anticodon_1	799	919	2.6e-16	60.6
TkA02G290150	`PF28879`	CCDC163	902	929	0.44	11.6
TkA02G290150	`PF24810`	RBD_LARS1	951	1028	1.8e-07	31.8
TkA02G290150	`PF28879`	CCDC163	1025	1062	0.44	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I116`	Arabidopsis thaliana	sp\|F4I116\|SYLC_ARATH Leucine--tRNA ligase, cytoplasmic	69.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card