RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G289000
Reference: TK1151 Chr: Chr02 Coordinates: 73845671-73848919 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2872 bp · TkA02G289000|TK1151|cDNA

GTTGACTGGCGTATGCCAAAAACCCAGCAAGCTACAATGGCGTCATCATCTGCGTCACCTCAAACTTTCATCTTCATCTCATGTTCACAATCCGACAACAGTTTACAGCGAAACCTCTGCGAAATTTTCTGCTTTTTCACACCCTAGCTAGATGCTAGACTTTTGAAGCTTTCTTTGATTCATCACCTACAACAGATATTCTCGATTTTTCTCATTAATTTCGGTTTGTAATTGATTTTTCGTTCTGGATTTTTGGGTCT...

CDS

Download CDS FASTA

1413 bp · TkA02G289000|TK1151|CDS

ATGAGTGAGATATTGCCATTTGGGAATGTTGGATATGATGCTTTTCTTGTGTTCTTGAGCTACTTGTATACCGGAAAAATGAAGGGGTCACCACCGGAGGTTTCAACATGCGTTCATGGTGGATGCCCTCATGATGCTTGTAGGCCCGCTATAGTGTTCGCTGTTGAATTGATGTACGCTTCTGTTATTTTTCAGGTGCCTGAGTTAGTTTCACTTTTTCAGCGACGTCTTCTTAACTTCATCGAAAAGGCATTTGTCGA...

Protein

Download Protein FASTA

470 aa · TkA02G289000|TK1151|PROTEIN

MSEILPFGNVGYDAFLVFLSYLYTGKMKGSPPEVSTCVHGGCPHDACRPAIVFAVELMYASVIFQVPELVSLFQRRLLNFIEKAFVEDVIPILLVAFHCELTHILTQCIHRVARSDLDDISLEKNLPPEAARDVKSLRTNHLPEPAQTPKSEEDPLREKRIRQIHKALDSDDVELVKLLLTESNITLDDAHALHYAVSYCDPKVVKELVDLDLADVNRRNPRGYTVLHVAAMRKEPSIMVCLLNKQVSVFETTRDGQNAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G289000
TK1151 IDTkA02G289000
OH-1004 IDLXL04_015763
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.700
Protein coverage (%)TK1151 100.000 / OH-1004 80.167
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G289000
LocationChr02:73845671-73848919 (+)
DescriptionSimilar to NPR1: BTB/POZ domain and ankyrin repeat-containing protein NPR1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g45110 Salicylic acid (SA)-binding substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of NPR1 in response to SA.
Negative regulation of defense responses in Arabidopsis by two NPR1 paralogs.2006 · DOI: 10.1111/j.1365-313x.2006.02903.x
NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants.2012 · DOI: 10.1038/nature11162
At4g19660 Salicylic acid (SA)-binding substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of NPR1 in the absence of SA.
An Arabidopsis NPR1-like gene, NPR4, is required for disease resistance.2005 · DOI: 10.1111/j.1365-313x.2004.02296.x
Negative regulation of defense responses in Arabidopsis by two NPR1 paralogs.2006 · DOI: 10.1111/j.1365-313x.2006.02903.x
NPR3 and NPR4 are receptors for the immune signal salicylic acid in plants.2012 · DOI: 10.1038/nature11162
Structural basis of salicylic acid perception by Arabidopsis NPR proteins.2020 · DOI: 10.1038/s41586-020-2596-y

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0767900 Salicylic acid (SA)-binding substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).
Functional analysis of rice NPR1-like genes reveals that OsNPR1/NH1 is the rice orthologue conferring disease resistance with enhanced herbivore susceptibility.2007 · DOI: 10.1111/j.1467-7652.2007.00243.x
Os03g0667100 Salicylic acid (SA)-binding substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).
Functional analysis of rice NPR1-like genes reveals that OsNPR1/NH1 is the rice orthologue conferring disease resistance with enhanced herbivore susceptibility.2007 · DOI: 10.1111/j.1467-7652.2007.00243.x
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015763 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009620 response to fungus Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009627 systemic acquired resistance Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process
GO:0010112 regulation of systemic acquired resistance Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0042742 defense response to bacterium Biological Process
KEGG gene cross-reference
ath:AT4G19660
ath:AT5G45110
dosa:Os01g0767900
dosa:Os03g0667100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483
Rank 1 · TkA02G289000 · TK1151
Nucleus0.289
Rank 2 · TkA02G289000 · TK1151
Cell membrane0.177
Rank 3 · TkA02G289000 · TK1151
Mitochondrion0.117
Rank 4 · TkA02G289000 · TK1151
Golgi apparatus0.105
Rank 5 · TkA02G289000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11900DUF3420116-165 aa
PF13606Ank_3164-185 aa
PF13637Ank_4164-206 aa
PF12796Ank_2165-246 aa
PF00023Ank165-187 aa
PF13857Ank_5190-198 aa
PF13857Ank_5190-209 aa
PF00023Ank191-220 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G289000PF11900DUF34201161651.2e-0732.4
TkA02G289000PF13606Ank_31641859e-0935.5
TkA02G289000PF13637Ank_41642062.2e-0731.7
TkA02G289000PF12796Ank_21652466.1e-1659.5
TkA02G289000PF00023Ank1651873.4e-1040.3
TkA02G289000PF13857Ank_51901984.2e-0730.9
TkA02G289000PF13857Ank_51902094.2e-0730.9
TkA02G289000PF00023Ank1912203.4e-1040.3
TkA02G289000PF13606Ank_31912179e-0935.5
TkA02G289000PF12796Ank_21932606.1e-1659.5
TkA02G289000PF13637Ank_41932422.2e-0731.7
TkA02G289000PF13857Ank_52082604.2e-0730.9
TkA02G289000PF00023Ank2232493.4e-1040.3
TkA02G289000PF13606Ank_32232479e-0935.5
TkA02G289000PF13637Ank_42272622.2e-0731.7
TkA02G289000PF12313NPR1_like_C2644553.3e-84282.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8L746Arabidopsis thalianasp|Q8L746|NPR3_ARATH Regulatory protein NPR358.300%Swiss-ProtHigh
Q5ICL9Arabidopsis thalianasp|Q5ICL9|NPR4_ARATH Regulatory protein NPR457.700%Swiss-ProtHigh
Q0JJ01Oryza sativa subsp. japonicasp|Q0JJ01|NPR2_ORYSJ BTB/POZ domain and ankyrin repeat-containing protein NPR260.100%Swiss-ProtHigh
Q75HA6Oryza sativa subsp. japonicasp|Q75HA6|NPR3_ORYSJ BTB/POZ domain and ankyrin repeat-containing protein NPR352.700%Swiss-ProtHigh

JBrowse

View in Genome Browser