TkA02G189770 | RubberDandelionOmics

Gene overview

TkA02G189770

Reference: TK1151 Chr: Chr02 Coordinates: 48688799-48692848 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2341 bp · TkA02G189770|TK1151|cDNA

CATAAACCTGAAAGTATAGGGATTCTTACACCACATTATTAGACACGTAATTACGTACATTGTGAAAGTTGGTGAGAGAGAGGAAACGGAACAAAAATTAAAGGAGAGCATCAAGAAACCTATACATACAACATAATACACGTATAGATTTAATCGGTTCCAGCATCCTCTCTGTTTCATTCTTGACGGAAATTTTCTGATTCATTTGAGAAAATTTCCAACTTCCGCCGATTAATTTCAATCTCTCCACGCTTATGTAA...

CDS

Download CDS FASTA

1728 bp · TkA02G189770|TK1151|CDS

ATGTCAGGCCTAGAAGGAAATGAGGCTTGTGATGAAAGAAAAGAAAGGAAGTCAGATCTTGATGATTCTGAAGATGAAATACGGCTATCAAGAATTGGATCCTTAAAAAAGAAGGCAATGAATGCATCCAATAAGTTCACCCATTCTCTTAAAAGAAGGCGAAAGAGGAAAGTTCATTACAAGGCTCCTTCAGTTCGCATAGAAGACATACGTGATGCAAATGAAGAGAGATGTGTCTTTGAATTAAGGAACAAGCTCCT...

Protein

Download Protein FASTA

575 aa · TkA02G189770|TK1151|PROTEIN

MSGLEGNEACDERKERKSDLDDSEDEIRLSRIGSLKKKAMNASNKFTHSLKRRRKRKVHYKAPSVRIEDIRDANEERCVFELRNKLLEKDLLPARHDDYHTLLRFLKARDFDIQKTILMWEEMLNWRKEFGTDTILEDYKFDELEEVQKQYPQGYHGVDKEGRPIYIERLGTAHPSKLMQITSVDRYIKYHVQEFEKTFNEKFPACSIAAKRPICSTTTILDVQGLGLKNFTPTAASILGAVTKVDNNYYPETLHRMFIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G189770`
TK1151 ID	TkA02G189770
OH-1004 ID	LXL04_016112
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 79.478 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G189770

Location Chr02:48688799-48692848 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55690`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At5g56160`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At4g39170`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At2g21520`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At1g75370`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016112 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008526 phosphatidylinositol transfer activity Molecular Function

KEGG gene cross-reference

ath:AT1G19650

ath:AT1G55690

ath:AT4G39170

ath:AT4G39180

ath:AT5G56160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.303

Rank 1 · TkA02G189770 · TK1151

Cytoplasm0.258

Rank 2 · TkA02G189770 · TK1151

Endoplasmic reticulum0.172

Rank 3 · TkA02G189770 · TK1151

Nucleus0.150

Rank 4 · TkA02G189770 · TK1151

Golgi apparatus0.144

Rank 5 · TkA02G189770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29075NOCA1_mid37-37 aa

PF01486K-box44-59 aa

PF28528UBA_Pinta75-116 aa

PF03765CRAL_TRIO_N95-121 aa

PF01486K-box136-154 aa

PF00650CRAL_TRIO149-312 aa

PF13716CRAL_TRIO_2234-313 aa

PF10805DUF2730471-551 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G189770	`PF29075`	NOCA1_mid	37	37	0.012	16.2
TkA02G189770	`PF01486`	K-box	44	59	5.2	8.0
TkA02G189770	`PF28528`	UBA_Pinta	75	116	0.25	12.3
TkA02G189770	`PF03765`	CRAL_TRIO_N	95	121	6.6e-06	26.9
TkA02G189770	`PF01486`	K-box	136	154	5.2	8.0
TkA02G189770	`PF00650`	CRAL_TRIO	149	312	6e-27	95.1
TkA02G189770	`PF13716`	CRAL_TRIO_2	234	313	0.0021	19.1
TkA02G189770	`PF10805`	DUF2730	471	551	0.0086	17.1
TkA02G189770	`PF05335`	DUF745	489	550	0.012	16.0
TkA02G189770	`PF29075`	NOCA1_mid	493	567	0.012	16.2
TkA02G189770	`PF01486`	K-box	501	550	5.2	8.0
TkA02G189770	`PF28528`	UBA_Pinta	534	548	0.25	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q501H5`	Arabidopsis thaliana	sp\|Q501H5\|SFH13_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH13	54.300%	Swiss-Prot	High
`F4K6D3`	Arabidopsis thaliana	sp\|F4K6D3\|SFH14_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH14	48.800%	Swiss-Prot	Medium
`F4JVA6`	Arabidopsis thaliana	sp\|F4JVA6\|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH6	44.600%	Swiss-Prot	Medium
`F4IHJ0`	Arabidopsis thaliana	sp\|F4IHJ0\|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH8	42.800%	Swiss-Prot	Medium
`Q8GXC6`	Arabidopsis thaliana	sp\|Q8GXC6\|SFH5_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH5	42.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card