LXL04_016112 | RubberDandelionOmics

Gene overview

LXL04_016112

Reference: OH-1004 Chr: Chr03 Coordinates: 110786405-110788556 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1402 bp · LXL04_016112|LXL04_016112|OH1004|cDNA

AGATTTCGACATTCAAAAAACAATCCTCATGTGGGAAGAGATGCTAAATTGGCGAAAAGAGTTTGGAACAGATACAATATTGGAGGATTATAAATTTGATGAGCTGGAAGAAGTACAGAAGCAGTACCCACAAGGGTACCATGgagttgataaagaagggagACCTATTTACATTGAAAGACTTGGGACAGCTCACCCTAGTAAACTTATGCAAATCACTTCAGTTGACCGCTACATAAAATACCATGTCCAAGAATTTG...

CDS

Download CDS FASTA

1374 bp · LXL04_016112|LXL04_016112|OH1004|CDS

ATGTGGGAAGAGATGCTAAATTGGCGAAAAGAGTTTGGAACAGATACAATATTGGAGGATTATAAATTTGATGAGCTGGAAGAAGTACAGAAGCAGTACCCACAAGGGTACCATGGAGTTGATAAAGAAGGGAGACCTATTTACATTGAAAGACTTGGGACAGCTCACCCTAGTAAACTTATGCAAATCACTTCAGTTGACCGCTACATAAAATACCATGTCCAAGAATTTGAAAAAACTTTTAATGAAAAGTTTCCCGC...

Protein

Download Protein FASTA

457 aa · LXL04_016112|LXL04_016112|OH1004|PROTEIN

MWEEMLNWRKEFGTDTILEDYKFDELEEVQKQYPQGYHGVDKEGRPIYIERLGTAHPSKLMQITSVDRYIKYHVQEFEKTFNEKFPACSIAAKKPICSTTTILDVQGLGLKNFTPTAASILGAVTKVDNNYYPETLHRMFIVNASGTFKKYLWPAAQKFLDAKTIPKIQVLEPKSLGKLLEVIDKSQLPDFLGGSCTCSSEGGCLRSNIGPWKDPEIMKVVNNSEATFATEITRVSCGKKKIDSSVHIQPMKGRSDTSTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016112`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016112

Location Chr03:110786405-110788556 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55690`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At5g56160`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At1g19650`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At4g39170`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At4g39180`	Required for transport of secretory proteins from the Golgi complex (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016112 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008526 phosphatidylinositol transfer activity Molecular Function

KEGG gene cross-reference

ath:AT1G19650

ath:AT1G55690

ath:AT4G39170

ath:AT4G39180

ath:AT5G56160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.293

Rank 1 · LXL04_016112 · OH-1004

Cytoplasm0.233

Rank 2 · LXL04_016112 · OH-1004

Cell membrane0.190

Rank 3 · LXL04_016112 · OH-1004

Golgi apparatus0.172

Rank 4 · LXL04_016112 · OH-1004

Mitochondrion0.151

Rank 5 · LXL04_016112 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00650.26CRAL_TRIO31-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016112	`PF00650.26`	CRAL_TRIO	31	194	3.1e-27	96.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q501H5`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH13	51.779%	Swiss-Prot	strong database homology
`F4K6D3`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH14	46.709%	Swiss-Prot	moderate database homology
`F4HP88`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH4	41.212%	Swiss-Prot	moderate database homology
`F4JVA6`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH6	41.176%	Swiss-Prot	moderate database homology
`F4JVA9`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH2	40.659%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card