TkA02G174600 | RubberDandelionOmics

Gene overview

TkA02G174600

Reference: TK1151 Chr: Chr02 Coordinates: 44869140-44871356 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1555 bp · TkA02G174600|TK1151|cDNA

TTTTAACAAGATATGTAGGTTCGCAACTTCGCACCAAGTTGGAACCCAAAACCGTAAAGTATTTCGAGTAAGCAACTCCAACATCGATCAAAACCCCTCTCGTCCTCTTCCCATCGCGAGCACGTAAAAATGGGGAGCGAGAACGAACCAGCGAAGCTACTGTTACCTTACCTTCAACGAGCCGATGAATTGCAAAAGCACGAGCCTCTCGTCGCCTACTACTGTCGGTTATATGCGATGGAACGTGGTTTGAGGATTCC...

CDS

Download CDS FASTA

1266 bp · TkA02G174600|TK1151|CDS

ATGGGGAGCGAGAACGAACCAGCGAAGCTACTGTTACCTTACCTTCAACGAGCCGATGAATTGCAAAAGCACGAGCCTCTCGTCGCCTACTACTGTCGGTTATATGCGATGGAACGTGGTTTGAGGATTCCTCAGAGTGAACGAACCAAAACCACAAATTCCCTACTCATTTCCCTCATGAACCAACTTGAAAAGGATAAGAAGACAGTGCAGTTGCAACCTGATGACAATCTCCACGTAGAAGGTTTTGCTTCAAATGT...

Protein

Download Protein FASTA

421 aa · TkA02G174600|TK1151|PROTEIN

MGSENEPAKLLLPYLQRADELQKHEPLVAYYCRLYAMERGLRIPQSERTKTTNSLLISLMNQLEKDKKTVQLQPDDNLHVEGFASNVFAKADKQDRAGRADLNTAKTFYAASIFFEILNQFGVLQPDLEQKQKYAAWKAADIRKAIKEGRKPVPGPPGGDLDKDPSDTSTTGYEDIEPSQPTTRHEPESHPSSHSFDRNDSQKFTNTFSSPSPPRDTPPPPPPPPPHSTMPPPPPPSTTQPPPPSNFPPPSSSDDYPSNN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G174600`
TK1151 ID	TkA02G174600
OH-1004 ID	LXL04_016211
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G174600

Location Chr02:44869140-44871356 (+)

Description Similar to LIP5: Protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26750`	Involved in the endosomal multivesicular bodies (MVB) pathway.	The Arabidopsis AAA ATPase SKD1 is involved in multivesicular endosome function and interacts with its positive regulator LYST-INTERACTING PROTEIN5.2007 · DOI: 10.1105/tpc.106.049346 Arabidopsis LIP5, a positive regulator of multivesicular body biogenesis, is a critical target of pathogen-responsive MAPK cascade in plant basal defense.2014 · DOI: 10.1371/journal.ppat.1004243

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016211 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016197 endosomal transport Biological Process

GO:0016236 macroautophagy Biological Process

GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway Biological Process

GO:0036258 multivesicular body assembly Biological Process

GO:0071985 multivesicular body sorting pathway Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:0098542 defense response to other organism Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:1903335 regulation of vacuolar transport Biological Process

KEGG gene cross-reference

ath:AT4G26750

ddi:DDB_G0271488

hsa:51534

pon:100173666

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.672

Rank 1 · TkA02G174600 · TK1151

Nucleus0.328

Rank 2 · TkA02G174600 · TK1151

Golgi apparatus0.171

Rank 3 · TkA02G174600 · TK1151

Endoplasmic reticulum0.101

Rank 4 · TkA02G174600 · TK1151

Lysosome / Vacuole0.069

Rank 5 · TkA02G174600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04652Vta112-148 aa

PF27614VPS35L_N25-67 aa

PF18097Vta1_C379-415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G174600	`PF04652`	Vta1	12	148	6.3e-47	159.9
TkA02G174600	`PF27614`	VPS35L_N	25	67	0.078	12.8
TkA02G174600	`PF18097`	Vta1_C	379	415	8.5e-10	38.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ15`	Arabidopsis thaliana	sp\|Q9SZ15\|LIP5_ARATH Protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5	50.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card