TkA01G630880 | RubberDandelionOmics

Gene overview

TkA01G630880

Reference: TK1151 Chr: Chr01 Coordinates: 159534028-159542279 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2129 bp · TkA01G630880|TK1151|cDNA

CGTCTCCTCCGGCGTTTGAGCCAGCAAAACTTTTGCAGCGGTCTTGATCTCACCAGCAAAACTTCGCCGCCATGCTATACCCAACAAACCCACCGTAGCTAAGCCCCACCGGGTTAATTTTCCCCATCAGTCCCACAGCTTCCAACGTCTGCATCACACACTCCGCCTGGAACTGCTCCGTCTGATCCAGTCGTTTGGTGTAGGAGTCTCCGTCGTGGAGGATGGTGGTTGTAGATTTTAGGCCGGCGGACCCGAATGAT...

CDS

Download CDS FASTA

1038 bp · TkA01G630880|TK1151|CDS

ATGCTTCAAATCCGACTAAGCAACAAGGCTACAACTTCAGAAAGTGGTGGAGGTGCAAAACTGCCATCAGGGGAAACAGTAACAGTCGCATGCCCTGACCACCTTGTTCTTGCTGAGCTTCCGGTAGCCAAAAGCCTCGGTTCCGCTAGCGGTGTTACTCTAGTGAAGACAGTCGGGCGTAGGTCCCGCCGCCCACTTGGCGAACGTGTCCACTTCTGTGTCCAATGTGACTTCCCCATCGCCATTTATGGACGTCTGAT...

Protein

Download Protein FASTA

345 aa · TkA01G630880|TK1151|PROTEIN

MLQIRLSNKATTSESGGGAKLPSGETVTVACPDHLVLAELPVAKSLGSASGVTLVKTVGRRSRRPLGERVHFCVQCDFPIAIYGRLIPCEHAFCLDCARSDSICYLCDERIQKIQTIKMMEGIFICAAPHCLKSFLKKTDFEAHVYAVHSDLVNPNAQKEVNESEPRKPTTSDSTVQAPTPRPVQDGEDRTQTQRLQPLQPPMVRPLMHPRPVDTRPHGFDGYEYPIPLPPPNFVVPGNPNVMGPGSFGQPMYVGPPPEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G630880`
TK1151 ID	TkA01G630880
OH-1004 ID	LXL04_000152
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G630880

Location Chr01:159534028-159542279 (-)

Description Similar to HAKAI: E3 ubiquitin-protein ligase HAKAI homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01160`	Probable E3 ubiquitin-protein ligase which is a subunit of the N6-methyltransferase complex, a multiprotein complex that mediates N6-methyladenosine (m6A) methylation at the 5'-[AG]GAC-3' consensus sites of some mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000152 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0001510 RNA methylation Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007015 actin filament organization Biological Process

GO:0007162 negative regulation of cell adhesion Biological Process

GO:0007548 sex differentiation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030155 regulation of cell adhesion Biological Process

GO:0030237 female sex determination Biological Process

GO:0030335 positive regulation of cell migration Biological Process

GO:0035282 segmentation Biological Process

GO:0045807 positive regulation of endocytosis Biological Process

KEGG gene cross-reference

ath:AT5G01160

dme:Dmel_CG10263

gga:417701

hsa:79872

mcf:101866734

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.763

Rank 1 · TkA01G630880 · TK1151

Cytoplasm0.366

Rank 2 · TkA01G630880 · TK1151

Endoplasmic reticulum0.035

Rank 3 · TkA01G630880 · TK1151

Cell membrane0.035

Rank 4 · TkA01G630880 · TK1151

Mitochondrion0.024

Rank 5 · TkA01G630880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13920zf-C3HC4_373-113 aa

PF00097zf-C3HC473-100 aa

PF14447Prok-RING_486-113 aa

PF14634zf-RING_586-108 aa

PF13445zf-RING_UBOX87-98 aa

PF14634zf-RING_5130-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G630880	`PF13920`	zf-C3HC4_3	73	113	0.012	16.1
TkA01G630880	`PF00097`	zf-C3HC4	73	100	0.14	12.7
TkA01G630880	`PF14447`	Prok-RING_4	86	113	1.1	9.9
TkA01G630880	`PF14634`	zf-RING_5	86	108	6.5	7.5
TkA01G630880	`PF13445`	zf-RING_UBOX	87	98	0.5	11.1
TkA01G630880	`PF14634`	zf-RING_5	130	137	6.5	7.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFC0`	Arabidopsis thaliana	sp\|Q9LFC0\|HAKAI_ARATH E3 ubiquitin-protein ligase HAKAI homolog	46.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card