LXL04_000152 | RubberDandelionOmics

Gene overview

LXL04_000152

Reference: OH-1004 Chr: Chr01 Coordinates: 3225076-3226281 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1050 bp · LXL04_000152|LXL04_000152|OH1004|cDNA

ATGCTTCAAATCCGACTAAGCAACAAGGCTACAACTTCAGAAAGTGGTGGAGGTGCAAAACTGGCATCAGGGGAAACAGTAACAGTCGCATGCCCTGACCACCTTGTTCTTGCTGAGCTTCCGGTAGCCAAAAGCCTCGGTTCCGCTAGCGGTGTTACTCTAGTGAAGACAGTCGGGCGTAGGTCCCGCCGCCCACTTGGCGAACGTGTCCACTTCTGTGTCCAATGTGACTTCCCCATCGCCATTTATGGACGTTTGAT...

CDS

Download CDS FASTA

1050 bp · LXL04_000152|LXL04_000152|OH1004|CDS

ATGCTTCAAATCCGACTAAGCAACAAGGCTACAACTTCAGAAAGTGGTGGAGGTGCAAAACTGGCATCAGGGGAAACAGTAACAGTCGCATGCCCTGACCACCTTGTTCTTGCTGAGCTTCCGGTAGCCAAAAGCCTCGGTTCCGCTAGCGGTGTTACTCTAGTGAAGACAGTCGGGCGTAGGTCCCGCCGCCCACTTGGCGAACGTGTCCACTTCTGTGTCCAATGTGACTTCCCCATCGCCATTTATGGACGTTTGAT...

Protein

Download Protein FASTA

349 aa · LXL04_000152|LXL04_000152|OH1004|PROTEIN

MLQIRLSNKATTSESGGGAKLASGETVTVACPDHLVLAELPVAKSLGSASGVTLVKTVGRRSRRPLGERVHFCVQCDFPIAIYGRLIPCEHAFCLDCARSDSICYLCDERIQKIQTIKMMEGIFICAAPHCLKSFLKKTDFEAHVYAVHSDLVNPNAQKEVNESEPRKPTTSDSTVQAPTPRPVQDGEDRTQTQRLQPLQPPMVRPLMHPRPVDTRPHGFDGYEYPIPLPPPNFVVPGNPNVMGPGSFGQPMYVGPPPEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000152`
TK1151 ID	TkA01G630880
OH-1004 ID	LXL04_000152
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000152

Location Chr01:3225076-3226281 (+)

Description Similar to HAKAI: E3 ubiquitin-protein ligase HAKAI homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01160`	Probable E3 ubiquitin-protein ligase which is a subunit of the N6-methyltransferase complex, a multiprotein complex that mediates N6-methyladenosine (m6A) methylation at the 5'-[AG]GAC-3' consensus sites of some mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000152 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0001510 RNA methylation Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007015 actin filament organization Biological Process

GO:0007162 negative regulation of cell adhesion Biological Process

GO:0007548 sex differentiation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030155 regulation of cell adhesion Biological Process

GO:0030237 female sex determination Biological Process

GO:0030335 positive regulation of cell migration Biological Process

GO:0035282 segmentation Biological Process

GO:0045807 positive regulation of endocytosis Biological Process

KEGG gene cross-reference

ath:AT5G01160

dme:Dmel_CG10263

gga:417701

hsa:79872

mcf:101866734

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.771

Rank 1 · LXL04_000152 · OH-1004

Cytoplasm0.361

Rank 2 · LXL04_000152 · OH-1004

Endoplasmic reticulum0.036

Rank 3 · LXL04_000152 · OH-1004

Cell membrane0.035

Rank 4 · LXL04_000152 · OH-1004

Mitochondrion0.023

Rank 5 · LXL04_000152 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFC0`	Arabidopsis thaliana	E3 ubiquitin-protein ligase HAKAI homolog	47.059%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card