TkA01G550470 | RubberDandelionOmics

Gene overview

TkA01G550470

Reference: TK1151 Chr: Chr01 Coordinates: 138371444-138372581 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · TkA01G550470|TK1151|cDNA

ATGGATCATGAGGTCCTACGCTTGTTACCGGAATGTAACCACGTGTTCCACCGTGGTTGCATAGATGAGTGGTTGGCTTTACGCGTTACCTGCCCTGTTTGTCGCGCAAGTTTGGTTCCAAAACCCAATAAACTCAGTCTACAGACTGATATGTATAGTGGCCCAAACGGGCCTACTAAAAGTCATGATTCGGTCGAATTGACTCATCTGACACATGATTTTTTTCTGATAGAAAATTGTCTCGTTCTTATTCAATGGGA...

CDS

Download CDS FASTA

495 bp · TkA01G550470|TK1151|CDS

ATGGATCATGAGGTCCTACGCTTGTTACCGGAATGTAACCACGTGTTCCACCGTGGTTGCATAGATGAGTGGTTGGCTTTACGCGTTACCTGCCCTGTTTGTCGCGCAAGTTTGGTTCCAAAACCCAATAAACTCAGTCTACAGACTGATATGTATAGTGGCCCAAACGGGCCTACTAAAAGTCATGATTCGGTCGAATTGACTCATCTGACACATGATTTTTTTCTGATAGAAAATTGTCTCGTTCTTATTCAATGGGA...

Protein

Download Protein FASTA

164 aa · TkA01G550470|TK1151|PROTEIN

MDHEVLRLLPECNHVFHRGCIDEWLALRVTCPVCRASLVPKPNKLSLQTDMYSGPNGPTKSHDSVELTHLTHDFFLIENCLVLIQWDICLRNDILKMSIDTRYGYQRMLKRMLRQFELFSPLSWAVGLGQWFATSHDNLEDKTVEASTRLMPMTASTDRFRVRN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G550470`
TK1151 ID	TkA01G550470
OH-1004 ID	LXL04_001260
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.100
Protein coverage (%)	TK1151 31.098 / OH-1004 13.600 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G550470

Location Chr01:138371444-138372581 (-)

Description Similar to FAX2: Protein FATTY ACID EXPORT 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35330`	RING-H2 finger protein ATL34.	No verified direct reference in this release
`At1g22500`	E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8, UBC10, UBC11, UBC28 and UBC29 in vitro.	No verified direct reference in this release
`At4g40070`	RING-H2 finger protein ATL32.	No verified direct reference in this release
`At5g06490`	Putative RING-H2 finger protein ATL71.	No verified direct reference in this release
`At2g35910`	RING-H2 finger protein ATL70.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001260 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006783 heme biosynthetic process Biological Process

GO:0006839 mitochondrial transport Biological Process

GO:0015908 fatty acid transport Biological Process

GO:0070453 regulation of heme biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

KEGG gene cross-reference

ath:AT2G26240

ath:AT3G43520

hsa:51522

pon:100190858

rno:171432

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.467

Rank 1 · TkA01G550470 · TK1151

Cytoplasm0.409

Rank 2 · TkA01G550470 · TK1151

Mitochondrion0.115

Rank 3 · TkA01G550470 · TK1151

Cell membrane0.091

Rank 4 · TkA01G550470 · TK1151

Endoplasmic reticulum0.068

Rank 5 · TkA01G550470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639zf-RING_24-35 aa

PF17123zf-RING_114-21 aa

PF13920zf-C3HC4_37-37 aa

PF12678zf-rbx19-35 aa

PF12861zf-ANAPC119-38 aa

PF14634zf-RING_59-35 aa

PF13445zf-RING_UBOX9-32 aa

PF17120zf-RING_169-32 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G550470	`PF13639`	zf-RING_2	4	35	1.2e-09	39.0
TkA01G550470	`PF17123`	zf-RING_11	4	21	0.00031	21.1
TkA01G550470	`PF13920`	zf-C3HC4_3	7	37	0.027	15.0
TkA01G550470	`PF12678`	zf-rbx1	9	35	4.4e-09	37.2
TkA01G550470	`PF12861`	zf-ANAPC11	9	38	4.6e-05	24.1
TkA01G550470	`PF14634`	zf-RING_5	9	35	0.00068	20.3
TkA01G550470	`PF13445`	zf-RING_UBOX	9	32	0.001	19.8
TkA01G550470	`PF17120`	zf-RING_16	9	32	0.0064	16.8
TkA01G550470	`PF00097`	zf-C3HC4	10	34	1.2e-05	25.7
TkA01G550470	`PF11793`	FANCL_C	10	26	0.26	12.3
TkA01G550470	`PF13923`	zf-C3HC4_2	11	34	1.8e-06	28.4
TkA01G550470	`PF11789`	zf-Nse	11	34	0.014	15.9
TkA01G550470	`PF23413`	zf_RING_Vps8_fungal	11	22	0.073	13.1
TkA01G550470	`PF23555`	zf-RING_Vps41	11	23	0.11	12.8
TkA01G550470	`PF08746`	zf-RING-like	11	34	0.2	12.5
TkA01G550470	`PF17122`	zf-C3H2C3	12	34	0.23	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7I1`	Arabidopsis thaliana	sp\|Q9C7I1\|ATL34_ARATH RING-H2 finger protein ATL34	60.800%	Swiss-Prot	Low
`Q9SK92`	Arabidopsis thaliana	sp\|Q9SK92\|ATL15_ARATH E3 ubiquitin-protein ligase ATL15	62.800%	Swiss-Prot	Low
`Q8W571`	Arabidopsis thaliana	sp\|Q8W571\|ATL32_ARATH RING-H2 finger protein ATL32	62.800%	Swiss-Prot	Low
`Q9FG21`	Arabidopsis thaliana	sp\|Q9FG21\|ATL71_ARATH Putative RING-H2 finger protein ATL71	56.400%	Swiss-Prot	Low
`Q8RX29`	Arabidopsis thaliana	sp\|Q8RX29\|ATL70_ARATH RING-H2 finger protein ATL70	63.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card