TkA01G542640 | RubberDandelionOmics

Gene overview

TkA01G542640

Reference: TK1151 Chr: Chr01 Coordinates: 136156813-136158578 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

990 bp · TkA01G542640|TK1151|cDNA

ATGAAAGAACGGTGTAAGGATAATTCAGGGGCGATATCGTCCAAAAGCAAACGTAAAACAAACGTCGTTAAACAAAAATCATGTATGGATATTTTCGAAGGTCATAAAAGCTACTATTTGATGCTTAACCTGCAACTAGGTATCAGGTACACAGTTGGAAAGATTACACCAGTTCCTACGTGTGAAGTCAGATCTTCTGATTTTGGGGCACGTGCCAGAATAAAGGTGTATTTTCCCAGGAAAGGCTCGCAATTTACGCC...

CDS

Download CDS FASTA

990 bp · TkA01G542640|TK1151|CDS

ATGAAAGAACGGTGTAAGGATAATTCAGGGGCGATATCGTCCAAAAGCAAACGTAAAACAAACGTCGTTAAACAAAAATCATGTATGGATATTTTCGAAGGTCATAAAAGCTACTATTTGATGCTTAACCTGCAACTAGGTATCAGGTACACAGTTGGAAAGATTACACCAGTTCCTACGTGTGAAGTCAGATCTTCTGATTTTGGGGCACGTGCCAGAATAAAGGTGTATTTTCCCAGGAAAGGCTCGCAATTTACGCC...

Protein

Download Protein FASTA

329 aa · TkA01G542640|TK1151|PROTEIN

MKERCKDNSGAISSKSKRKTNVVKQKSCMDIFEGHKSYYLMLNLQLGIRYTVGKITPVPTCEVRSSDFGARARIKVYFPRKGSQFTPPHYSVDFRWKDYCPMVFRNLREMFKLDAAEYMMSICGDDGLRELSSPGKSGSLFYLSHDDRFVIKTLRKSELKVLLKMLHSYYEHVKKYDNTLITKFFGLHEITLRGGKKVQFVVMGNMFKTELRIHRRYDLKGSYQGRFTNKDYMDEGTTLKDLDLEYEFHMDKSLREALFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G542640`
TK1151 ID	TkA01G542640
OH-1004 ID	LXL04_001364
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.000
Protein coverage (%)	TK1151 98.784 / OH-1004 21.382 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G542640

Location Chr01:136156813-136158578 (-)

Description Similar to PIP5K8: Phosphatidylinositol 4-phosphate 5-kinase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10900`	Phosphatidylinositol 4-phosphate 5-kinase 7.	No verified direct reference in this release
`At1g60890`	Phosphatidylinositol 4-phosphate 5-kinase 8.	No verified direct reference in this release
`At3g09920`	Plays a role in sugar-mediated root development.	PIP5K9, an Arabidopsis phosphatidylinositol monophosphate kinase, interacts with a cytosolic invertase to negatively regulate sugar-mediated root growth.2007 · DOI: 10.1105/tpc.106.045658
`At2g26420`	With DRP1A and DRP2B, required for the precise coordination of polar ARAC3/ROP6 and ARAC4/ROP2 placement and subsequent root hair positioning during planar polarity formation in root hair-forming cells, probably by mediating the correct basal-to-planar polarity switching of D6PK into the polar, lipid-enriched domain.	Arabidopsis D6PK is a lipid domain-dependent mediator of root epidermal planar polarity.2015 · DOI: 10.1038/nplants.2015.162

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0701800`	Involved in flowering.	OsPIPK 1, a rice phosphatidylinositol monophosphate kinase, regulates rice heading by modifying the expression of floral induction genes.2004 · DOI: 10.1023/b:plan.0000028796.14336.24

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001364 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016308 1-phosphatidylinositol-4-phosphate 5-kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10900

ath:AT1G60890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.522

Rank 1 · TkA01G542640 · TK1151

Cell membrane0.392

Rank 2 · TkA01G542640 · TK1151

Nucleus0.226

Rank 3 · TkA01G542640 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA01G542640 · TK1151

Golgi apparatus0.067

Rank 5 · TkA01G542640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01504PIP5K122-294 aa

PF10306FLILHELTA160-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G542640	`PF01504`	PIP5K	122	294	1.9e-70	238.1
TkA01G542640	`PF10306`	FLILHELTA	160	191	0.25	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUI2`	Arabidopsis thaliana	sp\|Q9SUI2\|PI5K7_ARATH Phosphatidylinositol 4-phosphate 5-kinase 7	75.200%	Swiss-Prot	High
`Q8RY89`	Arabidopsis thaliana	sp\|Q8RY89\|PI5K8_ARATH Phosphatidylinositol 4-phosphate 5-kinase 8	75.100%	Swiss-Prot	High
`Q8L850`	Arabidopsis thaliana	sp\|Q8L850\|PI5K9_ARATH Phosphatidylinositol 4-phosphate 5-kinase 9	67.500%	Swiss-Prot	High
`O48709`	Arabidopsis thaliana	sp\|O48709\|PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 3	58.800%	Swiss-Prot	High
`Q6EX42`	Oryza sativa subsp. japonica	sp\|Q6EX42\|PI5K1_ORYSJ Phosphatidylinositol 4-phosphate 5-kinase 1	75.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card