LXL04_001364 | RubberDandelionOmics

Gene overview

LXL04_001364

Reference: OH-1004 Chr: Chr01 Coordinates: 24930206-24946674 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4647 bp · LXL04_001364|LXL04_001364|OH1004|cDNA

ATGAAAAGCACAGTACACCTCAAAAACCATTTCAACACAACTAAACAAAATTGGGTTTTACGAAAACTTATGAACTCATACGAACACACAGGTTGTGATCAAACCAATACACGAACCTTAAAACAATTCAAAAACCGGCTATTAAACATACTTGTGGACCATCGGCCTCCATTATTGGTGCTTCAAAGCTTCAAAGCTTCCAATTCTGAATCGAGACATCCTCCATCTGCGCCTGCTTCGCTGCTTCCTCTGGACCTGTT...

CDS

Download CDS FASTA

4647 bp · LXL04_001364|LXL04_001364|OH1004|CDS

ATGAAAAGCACAGTACACCTCAAAAACCATTTCAACACAACTAAACAAAATTGGGTTTTACGAAAACTTATGAACTCATACGAACACACAGGTTGTGATCAAACCAATACACGAACCTTAAAACAATTCAAAAACCGGCTATTAAACATACTTGTGGACCATCGGCCTCCATTATTGGTGCTTCAAAGCTTCAAAGCTTCCAATTCTGAATCGAGACATCCTCCATCTGCGCCTGCTTCGCTGCTTCCTCTGGACCTGTT...

Protein

Download Protein FASTA

1548 aa · LXL04_001364|LXL04_001364|OH1004|PROTEIN

MKSTVHLKNHFNTTKQNWVLRKLMNSYEHTGCDQTNTRTLKQFKNRLLNILVDHRPPLLVLQSFKASNSESRHPPSAPASLLPLDLFCNFIFITSPPPQQIATFPNYRMTQQIDLHEGVYLGNVKGQIPHGKGRYTWSDGTVYDGNWEDGKMTGRGQISWSSGTSYSGDFSGGYLHGFGTLTNPDGSIYKGSWRLNIQNGLGRKQYSNSDVYDGCWKEGVHEGSGKYAWSNGNTYIGNWKSGKMCGRGVMKWLNGDLFDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001364`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001364

Location Chr01:24930206-24946674 (+)

Description Similar to PIP5K8: Phosphatidylinositol 4-phosphate 5-kinase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60890`	Phosphatidylinositol 4-phosphate 5-kinase 8.	No verified direct reference in this release
`At1g10900`	Phosphatidylinositol 4-phosphate 5-kinase 7.	No verified direct reference in this release
`At3g09920`	Plays a role in sugar-mediated root development.	PIP5K9, an Arabidopsis phosphatidylinositol monophosphate kinase, interacts with a cytosolic invertase to negatively regulate sugar-mediated root growth.2007 · DOI: 10.1105/tpc.106.045658
`At3g07960`	Phosphatidylinositol 4-phosphate 5-kinase 6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0701800`	Involved in flowering.	OsPIPK 1, a rice phosphatidylinositol monophosphate kinase, regulates rice heading by modifying the expression of floral induction genes.2004 · DOI: 10.1023/b:plan.0000028796.14336.24

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001364 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016308 1-phosphatidylinositol-4-phosphate 5-kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10900

ath:AT1G60890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.430

Rank 1 · LXL04_001364 · OH-1004

Nucleus0.264

Rank 2 · LXL04_001364 · OH-1004

Cell membrane0.175

Rank 3 · LXL04_001364 · OH-1004

Mitochondrion0.102

Rank 4 · LXL04_001364 · OH-1004

Endoplasmic reticulum0.085

Rank 5 · LXL04_001364 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02493.27MORN212-234 aa

PF02493.27MORN235-256 aa

PF02493.27MORN258-279 aa

PF01504.25PIP5K528-858 aa

PF01504.25PIP5K984-1057 aa

PF00141.29peroxidase1200-1312 aa

PF01504.25PIP5K1405-1513 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001364	`PF02493.27`	MORN	212	234	2.2e-34	116.0
LXL04_001364	`PF02493.27`	MORN	235	256	2.2e-34	116.0
LXL04_001364	`PF02493.27`	MORN	258	279	2.2e-34	116.0
LXL04_001364	`PF01504.25`	PIP5K	528	858	2.1e-157	523.5
LXL04_001364	`PF01504.25`	PIP5K	984	1057	2.1e-157	523.5
LXL04_001364	`PF00141.29`	peroxidase	1200	1312	2.3e-23	83.9
LXL04_001364	`PF01504.25`	PIP5K	1405	1513	2.1e-157	523.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY89`	Arabidopsis thaliana	Phosphatidylinositol 4-phosphate 5-kinase 8	63.268%	Swiss-Prot	weak database homology
`Q9SUI2`	Arabidopsis thaliana	Phosphatidylinositol 4-phosphate 5-kinase 7	63.685%	Swiss-Prot	weak database homology
`Q8L850`	Arabidopsis thaliana	Phosphatidylinositol 4-phosphate 5-kinase 9	49.494%	Swiss-Prot	weak database homology
`Q9SFB8`	Arabidopsis thaliana	Phosphatidylinositol 4-phosphate 5-kinase 6	42.536%	Swiss-Prot	weak database homology
`Q6EX42`	Oryza sativa subsp. japonica	Phosphatidylinositol 4-phosphate 5-kinase 1	55.469%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card