TkA01G498660 | RubberDandelionOmics

Gene overview

TkA01G498660

Reference: TK1151 Chr: Chr01 Coordinates: 124955499-124957928 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1578 bp · TkA01G498660|TK1151|cDNA

ACACCCTACAACTCTCATTTCTTTTCTCAAATTGTTTTACCATTCTTCGCCCCTTTTCCCTCTCATCATCCTCTTTCGTCACGCCCCCAACCCCCTGCCCCTCGACCGATGTCGTTACGAAGATCATTTCTATCCCGGCGAATCAGCAGCCGATCTAAATCTTCGAAAGATTACACGGCGTTAGATAATGTACAATTCAAATCGCAAGAAGTTTCCGGTGGTGTTGTTTATGGAACCGAAGCCGTCTCCGTTGAACCCAA...

CDS

Download CDS FASTA

1044 bp · TkA01G498660|TK1151|CDS

ACACCCTACAACTCTCATTTCTTTTCTCAAATTGTTTTACCATTCTTCGCCCCTTTTCCCTCTCATCATCCTCTTTCGTCACGCCCCCAACCCCCTGCCCCTCGACCGATGTCGTTACGAAGATCATTTCTATCCCGGCGAATCAGCAGCCGATCTAAATCTTCGAAAGATTACACGGCGTTAGATAATGTACAATTCAAATCGCAAGAAGTTTCCGGTGGTGTTGTTTATGGAACCGAAGCCGTCTCCGTTGAACCCAA...

Protein

Download Protein FASTA

347 aa · TkA01G498660|TK1151|PROTEIN

TPYNSHFFSQIVLPFFAPFPSHHPLSSRPQPPAPRPMSLRRSFLSRRISSRSKSSKDYTALDNVQFKSQEVSGGVVYGTEAVSVEPNNNENGEGSWSNMLPELIGEVIKRVEASEDRWPFRQSVVACGCVCKKWREIVKEMVKPPVHGGNITFPSCLKQPGPRDNQLQCLIKRDKKNSMFYLYLAASASFTEKGKFLLAARRYRHGAHTEYIISLDPQDLSQGSNAYVGKLSSDFLGTKFTLYDSQPPHNRAKQSNNKSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G498660`
TK1151 ID	TkA01G498660
OH-1004 ID	LXL04_039759
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	69.400
Protein coverage (%)	TK1151 76.369 / OH-1004 64.141 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G498660

Location Chr01:124955499-124957928 (-)

Description Similar to TULP7: Tubby-like F-box protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53320`	Tubby-like F-box protein 7.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0514300`	Tubby-like F-box protein 9.	No verified direct reference in this release
`Os01g0674500`	Tubby-like F-box protein 1.	No verified direct reference in this release
`Os05g0560400`	Tubby-like F-box protein 10.	No verified direct reference in this release
`Os01g0759100`	Tubby-like F-box protein 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039759 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009620 response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G53320

dosa:Os01g0759100

dosa:Os05g0514300

dosa:Os05g0560400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.441

Rank 1 · TkA01G498660 · TK1151

Cytoplasm0.424

Rank 2 · TkA01G498660 · TK1151

Cell membrane0.261

Rank 3 · TkA01G498660 · TK1151

Endoplasmic reticulum0.079

Rank 4 · TkA01G498660 · TK1151

Plastid0.050

Rank 5 · TkA01G498660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box42-56 aa

PF00646F-box96-140 aa

PF12937F-box-like122-139 aa

PF01167Tub157-345 aa

PF12937F-box-like214-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G498660	`PF00646`	F-box	42	56	0.00099	19.7
TkA01G498660	`PF00646`	F-box	96	140	0.00099	19.7
TkA01G498660	`PF12937`	F-box-like	122	139	0.011	16.3
TkA01G498660	`PF01167`	Tub	157	345	1.5e-54	186.1
TkA01G498660	`PF12937`	F-box-like	214	221	0.011	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VI8`	Arabidopsis thaliana	sp\|Q93VI8\|TLP7_ARATH Tubby-like F-box protein 7	65.800%	Swiss-Prot	High
`Q68Y48`	Oryza sativa subsp. japonica	sp\|Q68Y48\|TLP9_ORYSJ Tubby-like F-box protein 9	58.100%	Swiss-Prot	High
`Q5QM27`	Oryza sativa subsp. japonica	sp\|Q5QM27\|TLP1_ORYSJ Tubby-like F-box protein 1	58.900%	Swiss-Prot	High
`Q688Y7`	Oryza sativa subsp. japonica	sp\|Q688Y7\|TLP10_ORYSJ Tubby-like F-box protein 10	58.200%	Swiss-Prot	High
`Q94DT9`	Oryza sativa subsp. japonica	sp\|Q94DT9\|TLP2_ORYSJ Tubby-like F-box protein 2	49.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card