LXL04_039759 | RubberDandelionOmics

Gene overview

LXL04_039759

Reference: OH-1004 Chr: JAJTUU010000036.1 Coordinates: 163793-165814 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1191 bp · LXL04_039759|LXL04_039759|OH1004|cDNA

ATGCTCTTAATTTCCTCGATTCATTTCACCCTTTCTTCCATTTCTCAAATCTTCTCTCACCTCACCTTCTCTCTCCATCCCTCTGTCTACACGATGTCGTTGCGAAGGTCGTTCCTATCACGTCGGAATAGCAGCCGGTCGGATTCTCTGAAGGCGGAATTACCGACTTCGAAGCTGCCGGAGACTAACATTGCGGGTGTTTCAGTGGACGACGGTGTGTTTGGTGAAGCGGACTGCGAGGAGAATGGACGAGGTTCCTG...

CDS

Download CDS FASTA

1191 bp · LXL04_039759|LXL04_039759|OH1004|CDS

ATGCTCTTAATTTCCTCGATTCATTTCACCCTTTCTTCCATTTCTCAAATCTTCTCTCACCTCACCTTCTCTCTCCATCCCTCTGTCTACACGATGTCGTTGCGAAGGTCGTTCCTATCACGTCGGAATAGCAGCCGGTCGGATTCTCTGAAGGCGGAATTACCGACTTCGAAGCTGCCGGAGACTAACATTGCGGGTGTTTCAGTGGACGACGGTGTGTTTGGTGAAGCGGACTGCGAGGAGAATGGACGAGGTTCCTG...

Protein

Download Protein FASTA

396 aa · LXL04_039759|LXL04_039759|OH1004|PROTEIN

MLLISSIHFTLSSISQIFSHLTFSLHPSVYTMSLRRSFLSRRNSSRSDSLKAELPTSKLPETNIAGVSVDDGVFGEADCEENGRGSWSSMLPELLGEIIKRVETSDDRWPLRRNLVACGCVCRRWREVTREIVKPPVQSGKITFLSCLKQPGPRDSPIQCLIKRNKKNSVFYLYLSSTPSFTNKGKFLLAARRYRHGAHTEYIISLDPDDSSQGSNAYVGKLRSDFLGTKFTIYDSQPPHNGAKSVRRIASKQISPQVPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039759`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039759

Location JAJTUU010000036.1:163793-165814 (+)

Description Similar to TULP7: Tubby-like F-box protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53320`	Tubby-like F-box protein 7.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0514300`	Tubby-like F-box protein 9.	No verified direct reference in this release
`Os01g0674500`	Tubby-like F-box protein 1.	No verified direct reference in this release
`Os05g0560400`	Tubby-like F-box protein 10.	No verified direct reference in this release
`Os01g0759100`	Tubby-like F-box protein 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039759 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009620 response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G53320

dosa:Os01g0759100

dosa:Os05g0514300

dosa:Os05g0560400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · LXL04_039759 · OH-1004

Nucleus0.435

Rank 2 · LXL04_039759 · OH-1004

Cell membrane0.244

Rank 3 · LXL04_039759 · OH-1004

Endoplasmic reticulum0.064

Rank 4 · LXL04_039759 · OH-1004

Lysosome / Vacuole0.040

Rank 5 · LXL04_039759 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01167.25Tub148-391 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039759	`PF01167.25`	Tub	148	391	1.7e-90	303.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VI8`	Arabidopsis thaliana	Tubby-like F-box protein 7	63.889%	Swiss-Prot	strong database homology
`Q68Y48`	Oryza sativa subsp. japonica	Tubby-like F-box protein 9	66.978%	Swiss-Prot	strong database homology
`Q5QM27`	Oryza sativa subsp. japonica	Tubby-like F-box protein 1	61.517%	Swiss-Prot	strong database homology
`Q688Y7`	Oryza sativa subsp. japonica	Tubby-like F-box protein 10	63.190%	Swiss-Prot	strong database homology
`Q94DT9`	Oryza sativa subsp. japonica	Tubby-like F-box protein 2	56.231%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card