RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G419910
Reference: TK1151 Chr: Chr01 Coordinates: 104856065-104857336 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1230 bp · TkA01G419910|TK1151|cDNA

ATGGGGGCAGACGGGAACAACGGGGCGTTGCACGGGAAGTACGAACTAGGACGTCAATTGGGGCACGGAACATTTGCGAATGTGTACCACGCGAGGAACCTGCAGACCGGCAGGAGCGTGGCGATGAAAGTTGTTGGGAAGGAGAAGGTGATAAAGGCCGGCATGATGGATCAAATTAAGCGAGAGATTTCGGTGATGAAGATGGTACGCCACCCAAACATCGTCGAGCTTCACGAAGTCATGGCCAGTAAATCTAAGAT...

CDS

Download CDS FASTA

1230 bp · TkA01G419910|TK1151|CDS

ATGGGGGCAGACGGGAACAACGGGGCGTTGCACGGGAAGTACGAACTAGGACGTCAATTGGGGCACGGAACATTTGCGAATGTGTACCACGCGAGGAACCTGCAGACCGGCAGGAGCGTGGCGATGAAAGTTGTTGGGAAGGAGAAGGTGATAAAGGCCGGCATGATGGATCAAATTAAGCGAGAGATTTCGGTGATGAAGATGGTACGCCACCCAAACATCGTCGAGCTTCACGAAGTCATGGCCAGTAAATCTAAGAT...

Protein

Download Protein FASTA

409 aa · TkA01G419910|TK1151|PROTEIN

MGADGNNGALHGKYELGRQLGHGTFANVYHARNLQTGRSVAMKVVGKEKVIKAGMMDQIKREISVMKMVRHPNIVELHEVMASKSKIYFAMELVRGGELFSKIEKGRLKEDVARGYFQQLISAVDFCHSRDEEGNLKVTDFGLSAFSDHLHQDGLLHTTCGTPAYVAPEVIGKKGYDGAKADIWSCGVILYVLLAGFLPFQDENVVAMYRKIYRGDFRCPPWFSSDARRLITKLLDPNPDCRCTISKIMDSPWFKKAAPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G419910
TK1151 IDTkA01G419910
OH-1004 IDLXL04_002804
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)96.500
Protein coverage (%)TK1151 100.000 / OH-1004 82.456
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G419910
LocationChr01:104856065-104857336 (+)
DescriptionSimilar to CIPK6: CBL-interacting serine/threonine-protein kinase 6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g30960 CIPK serine-threonine protein kinases interact with CBL proteins.
Calcium-dependent modulation and plasma membrane targeting of the AKT2 potassium channel by the CBL4/CIPK6 calcium sensor/protein kinase complex.2011 · DOI: 10.1038/cr.2011.50
At5g45820 CIPK serine-threonine protein kinases interact with CBL proteins.
Constitutive activation and transgenic evaluation of the function of an arabidopsis PKS protein kinase.2002 · DOI: 10.1074/jbc.m205504200

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0206700 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
Os08g0441100 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
Os07g0678600 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002804 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0010540 basipetal auxin transport Biological Process
GO:0042538 hyperosmotic salinity response Biological Process
GO:0051592 response to calcium ion Biological Process
GO:0005634 nucleus Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT4G30960
ath:AT5G45820
dosa:Os01g0206700
dosa:Os07g0678600
dosa:Os08g0441100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.512
Rank 1 · TkA01G419910 · TK1151
Nucleus0.387
Rank 2 · TkA01G419910 · TK1151
Cell membrane0.259
Rank 3 · TkA01G419910 · TK1151
Endoplasmic reticulum0.055
Rank 4 · TkA01G419910 · TK1151
Golgi apparatus0.046
Rank 5 · TkA01G419910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase14-254 aa
PF07714PK_Tyr_Ser-Thr15-249 aa
PF03109ABC123-69 aa
PF04970LRAT37-62 aa
PF03109ABC156-148 aa
PF03822NAF280-338 aa
PF04970LRAT301-355 aa
PF07714PK_Tyr_Ser-Thr336-366 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G419910PF00069Pkinase142542.5e-59201.6
TkA01G419910PF07714PK_Tyr_Ser-Thr152494.4e-2589.2
TkA01G419910PF03109ABC123690.1412.0
TkA01G419910PF04970LRAT37620.2312.5
TkA01G419910PF03109ABC1561480.1412.0
TkA01G419910PF03822NAF2803388.5e-2381.0
TkA01G419910PF04970LRAT3013550.2312.5
TkA01G419910PF07714PK_Tyr_Ser-Thr3363664.4e-2589.2
TkA01G419910PF00069Pkinase3533722.5e-59201.6
TkA01G419910PF02149KA13703920.212.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O65554Arabidopsis thalianasp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 671.800%Swiss-ProtHigh
Q9FJ54Arabidopsis thalianasp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 2057.700%Swiss-ProtHigh
Q9LWM4Oryza sativa subsp. japonicasp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 559.800%Swiss-ProtHigh
Q6Z9F4Oryza sativa subsp. japonicasp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 659.100%Swiss-ProtHigh
Q7X996Oryza sativa subsp. japonicasp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 255.500%Swiss-ProtHigh

JBrowse

View in Genome Browser