RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G407380
Reference: TK1151 Chr: Chr01 Coordinates: 101684654-101689668 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3226 bp · TkA01G407380|TK1151|cDNA

ACTCCCAAACAATCATTCAAAAATGTTATGTTACAAACTTTTACTATGCTTTAACAAATCAATGAAACTTACACCGGTAATTCTTTCATGATCATGTTAATATCGTATATAATTGAAGTAGAGAAGGACAAAGGGTACCTGGAAATCGATTTCGAAACCACAGTGTGTATAAGACACCAAACTCTTGAACTGGTTTGCTGATGTAACTGGCAGAAGTCTTAGAACTGGTTTGCTGATGTAGCATAAGCATATCGTCGAAC...

CDS

Download CDS FASTA

756 bp · TkA01G407380|TK1151|CDS

ATGGAAGACATTGGTGATGAATACAAGAACATCGGTGATGAGTATAAAAATTATTGGGAAACCAATATGTTCCTCCAAGCCGAAGAATTCGATAGTTGGGGCGGACTGGAGGAAACGTTTTCCGGCTACTACGATTCGAGCTCGCCGGACGGACTTCAGTCGTCGGCGGCCTCCAAAAACATAGTTTCAGAGAGGAATAGGAGGAAAAAACTTAATGATAGGCTATTGGCTCTTCGAGGGGCGGTCCCCAACATAAGCAA...

Protein

Download Protein FASTA

251 aa · TkA01G407380|TK1151|PROTEIN

MEDIGDEYKNIGDEYKNYWETNMFLQAEEFDSWGGLEETFSGYYDSSSPDGLQSSAASKNIVSERNRRKKLNDRLLALRGAVPNISKMDKASIIKDAIDYIQHLREQERTIQDEIIKLESRKSESGIYDFDQETVFMSRERSKKKRINQSPDSNESRAFPVEVLELNVSYVGEKTALVSLKCRKRRDTMVKICEVFESLKLIVVTANITTFPDTLFKTLFIQADEEEIDVLKLQIHTAICDLNDPLSPMST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G407380
TK1151 IDTkA01G407380
OH-1004 IDLXL04_017961
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)68.200
Protein coverage (%)TK1151 92.829 / OH-1004 95.851
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G407380
LocationChr01:101684654-101689668 (+)
DescriptionSimilar to BHLH35: Transcription factor bHLH35
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g57150 Transcription factor bHLH35. No verified direct reference in this release
At4g29930 Transcription factor bHLH27. No verified direct reference in this release
At2g28160 Transcription factor.
The essential basic helix-loop-helix protein FIT1 is required for the iron deficiency response.2004 · DOI: 10.1105/tpc.104.024315
AtbHLH29 of Arabidopsis thaliana is a functional ortholog of tomato FER involved in controlling iron acquisition in strategy I plants.2005 · DOI: 10.1038/sj.cr.7290331

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0301500 Transcription factor involved in phosphate starvation response.
RERJ1, a jasmonic acid-responsive gene from rice, encodes a basic helix-loop-helix protein.2004 · DOI: 10.1016/j.bbrc.2004.10.126
Stress-induced expression of the transcription factor RERJ1 is tightly regulated in response to jasmonic acid accumulation in rice.2013 · DOI: 10.1007/s00709-012-0400-z
OsbHLH6 interacts with OsSPX4 and regulates the phosphate starvation response in rice.2021 · DOI: 10.1111/tpj.15061
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017961 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009555 pollen development Biological Process
GO:0009867 jasmonic acid mediated signaling pathway Biological Process
GO:0010039 response to iron ion Biological Process
GO:0034756 regulation of iron ion transport Biological Process
GO:0048658 anther wall tapetum development Biological Process
GO:0048831 regulation of shoot system development Biological Process
GO:0055062 phosphate ion homeostasis Biological Process
GO:0080040 positive regulation of cellular response to phosphate starvation Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT2G16910
ath:AT2G28160
ath:AT4G29930
ath:AT5G57150
dosa:Os04g0301500
osa:4335417
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.928
Rank 1 · TkA01G407380 · TK1151
Cytoplasm0.173
Rank 2 · TkA01G407380 · TK1151
Cell membrane0.032
Rank 3 · TkA01G407380 · TK1151
Endoplasmic reticulum0.019
Rank 4 · TkA01G407380 · TK1151
Plastid0.010
Rank 5 · TkA01G407380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08910Aida_N22-78 aa
PF23177bHLH_IRO359-120 aa
PF00010HLH61-105 aa
PF23173bHLH_SAC5163-106 aa
PF10482CtIP_N97-122 aa
PF23177bHLH_IRO3138-149 aa
PF00010HLH139-149 aa
PF22754bHLH-TF_ACT-like_plant165-239 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G407380PF08910Aida_N22780.06114.4
TkA01G407380PF23177bHLH_IRO3591202.1e-0835.1
TkA01G407380PF00010HLH611055.9e-1245.9
TkA01G407380PF23173bHLH_SAC51631060.0007120.1
TkA01G407380PF10482CtIP_N971220.3911.4
TkA01G407380PF23177bHLH_IRO31381492.1e-0835.1
TkA01G407380PF00010HLH1391495.9e-1245.9
TkA01G407380PF22754bHLH-TF_ACT-like_plant1652394e-2485.2
TkA01G407380PF00010HLH1832045.9e-1245.9
TkA01G407380PF23173bHLH_SAC511841980.0007120.1
TkA01G407380PF10482CtIP_N2252410.3911.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q2HIV9Arabidopsis thalianasp|Q2HIV9|BH035_ARATH Transcription factor bHLH3553.000%Swiss-ProtHigh
Q700E3Arabidopsis thalianasp|Q700E3|BH027_ARATH Transcription factor bHLH2750.200%Swiss-ProtHigh
Q0V7X4Arabidopsis thalianasp|Q0V7X4|FIT_ARATH Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR31.200%Swiss-ProtMedium
Q0JEB7Oryza sativa subsp. japonicasp|Q0JEB7|BH006_ORYSJ Transcription factor BHLH635.700%Swiss-ProtMedium

JBrowse

View in Genome Browser