TkA01G377630 | RubberDandelionOmics

Gene overview

TkA01G377630

Reference: TK1151 Chr: Chr01 Coordinates: 94222735-94225536 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · TkA01G377630|TK1151|cDNA

ATGGTGGCTATAAAGCGTGTCGTTGACTACGCCGTCAAGGTCCGAATCAAAGCCGACAAGACTGGAGTCGAGACAACAAATGTGAAGATGTCGATGAACCCTTTCTGCGAAATAGCTCTCGAAGAAGCTCTTAAGATCAAGGAGTCAAAGATTGCTTCGGAGGTGATTGCTGTGAGCATCGGTCCAGCTCAGTGCGCTGACACTCTCCGGACCGGCCTAGCAATGGGTGCAGACCGTGCGATTCACGTCGATGCACCAGC...

CDS

Download CDS FASTA

834 bp · TkA01G377630|TK1151|CDS

ATGGTGGCTATAAAGCGTGTCGTTGACTACGCCGTCAAGGTCCGAATCAAAGCCGACAAGACTGGAGTCGAGACAACAAATGTGAAGATGTCGATGAACCCTTTCTGCGAAATAGCTCTCGAAGAAGCTCTTAAGATCAAGGAGTCAAAGATTGCTTCGGAGGTGATTGCTGTGAGCATCGGTCCAGCTCAGTGCGCTGACACTCTCCGGACCGGCCTAGCAATGGGTGCAGACCGTGCGATTCACGTCGATGCACCAGC...

Protein

Download Protein FASTA

277 aa · TkA01G377630|TK1151|PROTEIN

MVAIKRVVDYAVKVRIKADKTGVETTNVKMSMNPFCEIALEEALKIKESKIASEVIAVSIGPAQCADTLRTGLAMGADRAIHVDAPATLYPLSIAKILKALVDVEKPGLLILGKQAIDDDCNQTGQMVAGLLNWPQGTFASKVILDKEMNVATVDREVDGGLETLCLDLPAVITTDLRLNQPRYATLPNIMKAKSKPIKKISLEELKVEMRSDMEVIQVTEPPKRKAGVVLSSVDELVDKLKNEAHAGGCGCANPQRQAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G377630`
TK1151 ID	TkA01G377630
OH-1004 ID	LXL04_003278
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 88.809 / OH-1004 17.324 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G377630

Location Chr01:94222735-94225536 (-)

Description Similar to ETFB: Electron transfer flavoprotein subunit beta, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43430`	Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases.	The mitochondrial electron transfer flavoprotein complex is essential for survival of Arabidopsis in extended darkness.2006 · DOI: 10.1111/j.1365-313x.2006.02826.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0182800`	Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases.	No verified direct reference in this release
`UniProt: A2XQV4`	Heterodimeric electron transfer flavoprotein that accepts electrons from several mitochondrial dehydrogenases.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003278 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006552 L-leucine catabolic process Biological Process

GO:0009063 amino acid catabolic process Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0033539 fatty acid beta-oxidation using acyl-CoA dehydrogenase Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0045251 electron transfer flavoprotein complex Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0009055 electron transfer activity Molecular Function

KEGG gene cross-reference

ath:AT5G43430

ddi:DDB_G0277991

dosa:Os04g0182800

rno:292845

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · TkA01G377630 · TK1151

Mitochondrion0.225

Rank 2 · TkA01G377630 · TK1151

Nucleus0.151

Rank 3 · TkA01G377630 · TK1151

Plastid0.135

Rank 4 · TkA01G377630 · TK1151

Peroxisome0.096

Rank 5 · TkA01G377630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01012ETF23-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G377630	`PF01012`	ETF	23	205	3.1e-39	135.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSW8`	Arabidopsis thaliana	sp\|Q9LSW8\|ETFB_ARATH Electron transfer flavoprotein subunit beta, mitochondrial	78.900%	Swiss-Prot	High
`Q7F9U3`	Oryza sativa subsp. japonica	sp\|Q7F9U3\|ETFB_ORYSJ Electron transfer flavoprotein subunit beta, mitochondrial	75.300%	Swiss-Prot	High
`A2XQV4`	Oryza sativa subsp. indica	sp\|A2XQV4\|ETFB_ORYSI Electron transfer flavoprotein subunit beta, mitochondrial	74.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card