TkA01G215940 | RubberDandelionOmics

Gene overview

TkA01G215940

Reference: TK1151 Chr: Chr01 Coordinates: 55051202-55054502 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2659 bp · TkA01G215940|TK1151|cDNA

CACAAGGTTCTCGCCTTGTCGACCTCGGCGAATGGCGATACCGCCCTCTTTGCCCGTTGGAGATTCGTAACGGCTATATTTCAAGTTTTAATCTCCAACAAAATGACACCACCCTTTCCATTTTCGTTTTCAACTTTCCATCAACAGTCCTCTTCTCTCTCTCATCTTTAACGCCATCATTTTCTCTGTATTCTTCCTCGACTCTTGATTTTGGCTTTCAAAGTTCTTGATTTTATTCACACTTGTCTCCCATGGCTCCT...

CDS

Download CDS FASTA

1917 bp · TkA01G215940|TK1151|CDS

ATGGCTCCTACCCCTTCTTCCAAATCAAATCACACCCATCTAAGGACGCCCCAATCAAAGCATCGCCTGAATTTTAACTCCACAAAACCCTCCCCAAACCCTAATTCTGCCGTCAAAGAACCCCATCAACTAGCAGATCATCCAGTTGAAGTTGTCGGCCGGATTAGGGACTATCCTGACCAGAAAGATAAACCCATCTCCGTTTTGCAGGTCAATTCTGACGGTCGTTCAGTCAGGGTCAGAACTGAAATCGGATACCG...

Protein

Download Protein FASTA

638 aa · TkA01G215940|TK1151|PROTEIN

MAPTPSSKSNHTHLRTPQSKHRLNFNSTKPSPNPNSAVKEPHQLADHPVEVVGRIRDYPDQKDKPISVLQVNSDGRSVRVRTEIGYRDFTLDGVSEDQDLDGFYRNFVQPRINGVKLGDKCTIMMYGPTGSGKSHTMFGSAKQQGIVYKSLSDILGNENDEIDEQKVGVGTFVQVTVLEIYNEEIYDLLSTNSKAGFNIGWSKGNASKVKLEVMGKKAKNATFISGTEAGKISKEIQKVEKRRIIKSTFCNERSSRSHCM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G215940`
TK1151 ID	TkA01G215940
OH-1004 ID	LXL04_001277
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	34.900
Protein coverage (%)	TK1151 42.947 / OH-1004 22.697 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G215940

Location Chr01:55051202-55054502 (-)

Description Similar to KIN14F: Kinesin-like protein KIN-14F

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14330`	Probable plus end-directed motor protein that may contribute to the transport of Golgi-derived vesicles in the phragmoplast.	A novel plant kinesin-related protein specifically associates with the phragmoplast organelles.2001 · DOI: 10.1105/tpc.010225

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0810200`	Kinesin-like protein KIN-10A.	No verified direct reference in this release
`UniProt: Q0E2L3`	Kinesin-like protein KIN-14D.	No verified direct reference in this release
`Os12g0616000`	Kinesin-like protein KIN-14R.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001277 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007097 nuclear migration Biological Process

GO:0031534 minus-end directed microtubule sliding Biological Process

GO:0051647 nucleus localization Biological Process

GO:0005874 microtubule Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0003779 actin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

dosa:Os03g0301800

dosa:Os12g0547500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.539

Rank 1 · TkA01G215940 · TK1151

Cytoplasm0.472

Rank 2 · TkA01G215940 · TK1151

Cell membrane0.108

Rank 3 · TkA01G215940 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA01G215940 · TK1151

Lysosome / Vacuole0.028

Rank 5 · TkA01G215940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04738Lant_dehydr_N30-80 aa

PF00225Kinesin72-372 aa

PF16796Microtub_bd119-189 aa

PF04859DUF641398-450 aa

PF04738Lant_dehydr_N411-528 aa

PF02601Exonuc_VII_L414-514 aa

PF00225Kinesin449-484 aa

PF04859DUF641460-514 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G215940	`PF04738`	Lant_dehydr_N	30	80	2.7	6.8
TkA01G215940	`PF00225`	Kinesin	72	372	1.3e-61	209.2
TkA01G215940	`PF16796`	Microtub_bd	119	189	6.2e-08	33.4
TkA01G215940	`PF04859`	DUF641	398	450	3.2	8.8
TkA01G215940	`PF04738`	Lant_dehydr_N	411	528	2.7	6.8
TkA01G215940	`PF02601`	Exonuc_VII_L	414	514	0.78	9.9
TkA01G215940	`PF00225`	Kinesin	449	484	1.3e-61	209.2
TkA01G215940	`PF04859`	DUF641	460	514	3.2	8.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWI7`	Arabidopsis thaliana	sp\|Q8VWI7\|KN10A_ARATH Kinesin-like protein KIN-10A	68.800%	Swiss-Prot	High
`Q6K990`	Oryza sativa subsp. japonica	sp\|Q6K990\|KN10A_ORYSJ Kinesin-like protein KIN-10A	57.900%	Swiss-Prot	High
`Q0E2L3`	Oryza sativa subsp. japonica	sp\|Q0E2L3\|KN14D_ORYSJ Kinesin-like protein KIN-14D	30.700%	Swiss-Prot	Medium
`Q2QM62`	Oryza sativa subsp. japonica	sp\|Q2QM62\|KN14R_ORYSJ Kinesin-like protein KIN-14R	30.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card