TkA01G080290 | RubberDandelionOmics

Gene overview

TkA01G080290

Reference: TK1151 Chr: Chr01 Coordinates: 20520602-20526267 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4314 bp · TkA01G080290|TK1151|cDNA

ACCTCGCTATAATGGATACTGTAAATCCAATAATGGATGTTTATGCAGATAGTTCTGTTCCAACTACACCCCCACTATACCAATGGAAGATAGTCAAGATACCCAACTTACTACTACAGAAACAATGGAAGAGAACCAGAGACTACTATTTGCCATTAACGGAGAGCGCTTTGAGCTCTCTTCGATAGATCCTTCAATTACTCTGCTTCAATTCCTTCGTTCTCATACTCGCTTCAAGAGTGTGAAGCTCGGTTGCGGTG...

CDS

Download CDS FASTA

4050 bp · TkA01G080290|TK1151|CDS

ATGGAAGATAGTCAAGATACCCAACTTACTACTACAGAAACAATGGAAGAGAACCAGAGACTACTATTTGCCATTAACGGAGAGCGCTTTGAGCTCTCTTCGATAGATCCTTCAATTACTCTGCTTCAATTCCTTCGTTCTCATACTCGCTTCAAGAGTGTGAAGCTCGGTTGCGGTGAAGGTGGTTGTGGTGCTTGTAATGTTCTACTATCCAAATTCGACTCCAACCTCAATCAAGTTGAAGATTACAAAGTGAGTTC...

Protein

Download Protein FASTA

1349 aa · TkA01G080290|TK1151|PROTEIN

MEDSQDTQLTTTETMEENQRLLFAINGERFELSSIDPSITLLQFLRSHTRFKSVKLGCGEGGCGACNVLLSKFDSNLNQVEDYKVSSCLTPLCSINGCSITTTEGLGNIKDGFHSIHQRFAGFHGSQCGFCTPGMCVSLFSALVNADKKTEHQEPPVGFSNLTVSEAEKSISGNLCRCTGYRPIADVCKSFACDVDMEDLGLNSFWKKGDDVDSKSQKLPFYDPKQICTYPEFLKKEHKSPMYMEYNKRFWYTPVSINEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G080290`
TK1151 ID	TkA01G080290
OH-1004 ID	LXL04_005110
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G080290

Location Chr01:20520602-20526267 (-)

Description Similar to AAO2: Indole-3-acetaldehyde oxidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20960`	In higher plants aldehyde oxidases (AO) appear to be homo- and heterodimeric assemblies of AO subunits with probably different physiological functions.	No verified direct reference in this release
`At2g27150`	In higher plants aldehyde oxidases (AO) appear to be homo- and heterodimeric assemblies of AO subunits with probably different physiological functions.	Abscisic aldehyde oxidase in leaves of Arabidopsis thaliana.2000 · DOI: 10.1046/j.1365-313x.2000.00812.x The Arabidopsis aldehyde oxidase 3 (AAO3) gene product catalyzes the final step in abscisic acid biosynthesis in leaves.2000 · DOI: 10.1073/pnas.220426197 Comparative studies on the Arabidopsis aldehyde oxidase (AAO) gene family revealed a major role of AAO3 in ABA biosynthesis in seeds.2004 · DOI: 10.1093/pcp/pch198 Both abscisic acid (ABA)-dependent and ABA-independent pathways govern the induction of NCED3, AAO3 and ABA1 in response to salt stress.2006 · DOI: 10.1111/j.1365-3040.2006.01576.x
`At3g43600`	In higher plant aldehyde oxidases (AO) appear to be homo- and heterodimeric assemblies of AO subunits with probably different physiological functions.	No verified direct reference in this release
`At1g04580`	Aldehyde oxidase with a broad substrate specificity.	An aldehyde oxidase in developing seeds of Arabidopsis converts benzaldehyde to benzoic Acid.2009 · DOI: 10.1104/pp.109.135848 Aldehyde Oxidase 4 Plays a Critical Role in Delaying Silique Senescence by Catalyzing Aldehyde Detoxification.2017 · DOI: 10.1104/pp.16.01939

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005110 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0110096 cellular response to aldehyde Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0004031 aldehyde oxidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04580

ath:AT2G27150

ath:AT3G43600

ath:AT5G20960

zma:542229

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.725

Rank 1 · TkA01G080290 · TK1151

Nucleus0.245

Rank 2 · TkA01G080290 · TK1151

Mitochondrion0.098

Rank 3 · TkA01G080290 · TK1151

Peroxisome0.083

Rank 4 · TkA01G080290 · TK1151

Endoplasmic reticulum0.044

Rank 5 · TkA01G080290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00111Fer224-92 aa

PF01799Fer2_2102-188 aa

PF00111Fer2125-132 aa

PF00941FAD_binding_5251-425 aa

PF03450CO_deh_flav_C447-547 aa

PF01315Ald_Xan_dh_C605-709 aa

PF02738MoCoBD_1739-968 aa

PF20256MoCoBD_2997-1260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G080290	`PF00111`	Fer2	24	92	4.1e-06	27.4
TkA01G080290	`PF01799`	Fer2_2	102	188	1e-20	74.3
TkA01G080290	`PF00111`	Fer2	125	132	4.1e-06	27.4
TkA01G080290	`PF00941`	FAD_binding_5	251	425	2.9e-38	132.1
TkA01G080290	`PF03450`	CO_deh_flav_C	447	547	9.7e-20	71.3
TkA01G080290	`PF01315`	Ald_Xan_dh_C	605	709	2.2e-24	86.6
TkA01G080290	`PF02738`	MoCoBD_1	739	968	4.3e-79	265.7
TkA01G080290	`PF20256`	MoCoBD_2	997	1260	1.5e-69	235.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7G193`	Arabidopsis thaliana	sp\|Q7G193\|ALDO1_ARATH Indole-3-acetaldehyde oxidase	60.400%	Swiss-Prot	High
`Q7G9P4`	Arabidopsis thaliana	sp\|Q7G9P4\|ALDO3_ARATH Abscisic-aldehyde oxidase	59.500%	Swiss-Prot	High
`Q7G192`	Arabidopsis thaliana	sp\|Q7G192\|ALDO2_ARATH Indole-3-acetaldehyde oxidase	60.500%	Swiss-Prot	High
`Q7G191`	Arabidopsis thaliana	sp\|Q7G191\|ALDO4_ARATH Aldehyde oxidase 4	59.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card