LXL04_005110 | RubberDandelionOmics

Gene overview

LXL04_005110

Reference: OH-1004 Chr: Chr01 Coordinates: 155149339-155154182 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4204 bp · LXL04_005110|LXL04_005110|OH1004|cDNA

ATGGCCAACTATAAGTCTATAAGGACCAAACCCGTATTTTACTCTTTAATATAATAGACTTTTGTGCATTGAAATTGTCAAACACTCAAACCGCCGTAATGGATGTTTATGCAGATAGTTCTGTTCCAACTACACCCCCACTATACCAATGGAAGATAGTCAAGATACCCAACTTACTACTACAGAAACAATGGAAGAGAACCAGAGACTACTATTTGCCATTAACGGAGAGCGCTTTGAGCTCTCTTCGATAGATCCTT...

CDS

Download CDS FASTA

4050 bp · LXL04_005110|LXL04_005110|OH1004|CDS

ATGGAAGATAGTCAAGATACCCAACTTACTACTACAGAAACAATGGAAGAGAACCAGAGACTACTATTTGCCATTAACGGAGAGCGCTTTGAGCTCTCTTCGATAGATCCTTCAATTACTCTGCTTCAATTCCTTCGTTCTCATACTCGCTTCAAGAGTGTGAAGCTCGGTTGCGGTGAAGGTGGTTGTGGTGCTTGTAATGTTCTACTATCCAAATTCGACTCCAACCTCAATCAAGTTGAAGATTACAAAGTGAGTTC...

Protein

Download Protein FASTA

1349 aa · LXL04_005110|LXL04_005110|OH1004|PROTEIN

MEDSQDTQLTTTETMEENQRLLFAINGERFELSSIDPSITLLQFLRSHTRFKSVKLGCGEGGCGACNVLLSKFDSNLNQVEDYKVSSCLTPLCSINGCSITTTEGLGNIKDGFHSIHQRFAGFHGSQCGFCTPGMCVSLFSALVNADKKTEHQEPPVGFSNLTVSEAEKSISGNLCRCTGYRPIADVCKSFACDVDMEDLGLNSFWKKGDDVDSKSQKLPFYDPKQICTYPEFLKKEHKSPMYMEYNKRFWYTPVSINEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005110`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005110

Location Chr01:155149339-155154182 (+)

Description Similar to AAO2: Indole-3-acetaldehyde oxidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43600`	In higher plant aldehyde oxidases (AO) appear to be homo- and heterodimeric assemblies of AO subunits with probably different physiological functions.	No verified direct reference in this release
`At5g20960`	In higher plants aldehyde oxidases (AO) appear to be homo- and heterodimeric assemblies of AO subunits with probably different physiological functions.	No verified direct reference in this release
`At2g27150`	In higher plants aldehyde oxidases (AO) appear to be homo- and heterodimeric assemblies of AO subunits with probably different physiological functions.	Abscisic aldehyde oxidase in leaves of Arabidopsis thaliana.2000 · DOI: 10.1046/j.1365-313x.2000.00812.x The Arabidopsis aldehyde oxidase 3 (AAO3) gene product catalyzes the final step in abscisic acid biosynthesis in leaves.2000 · DOI: 10.1073/pnas.220426197 Comparative studies on the Arabidopsis aldehyde oxidase (AAO) gene family revealed a major role of AAO3 in ABA biosynthesis in seeds.2004 · DOI: 10.1093/pcp/pch198 Both abscisic acid (ABA)-dependent and ABA-independent pathways govern the induction of NCED3, AAO3 and ABA1 in response to salt stress.2006 · DOI: 10.1111/j.1365-3040.2006.01576.x
`At1g04580`	Aldehyde oxidase with a broad substrate specificity.	An aldehyde oxidase in developing seeds of Arabidopsis converts benzaldehyde to benzoic Acid.2009 · DOI: 10.1104/pp.109.135848 Aldehyde Oxidase 4 Plays a Critical Role in Delaying Silique Senescence by Catalyzing Aldehyde Detoxification.2017 · DOI: 10.1104/pp.16.01939

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005110 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0110096 cellular response to aldehyde Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0004031 aldehyde oxidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04580

ath:AT2G27150

ath:AT3G43600

ath:AT5G20960

zma:542229

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.728

Rank 1 · LXL04_005110 · OH-1004

Nucleus0.246

Rank 2 · LXL04_005110 · OH-1004

Mitochondrion0.099

Rank 3 · LXL04_005110 · OH-1004

Peroxisome0.083

Rank 4 · LXL04_005110 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_005110 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00111.33Fer224-92 aa

PF01799.26Fer2_2102-188 aa

PF00941.28FAD_binding_5251-425 aa

PF03450.23CO_deh_flav_C447-547 aa

PF01315.28Ald_Xan_dh_C605-709 aa

PF02738.24MoCoBD_1739-968 aa

PF20256.4MoCoBD_2997-1260 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005110	`PF00111.33`	Fer2	24	92	4.1e-06	27.4
LXL04_005110	`PF01799.26`	Fer2_2	102	188	1e-20	74.3
LXL04_005110	`PF00941.28`	FAD_binding_5	251	425	3e-38	132.0
LXL04_005110	`PF03450.23`	CO_deh_flav_C	447	547	9.7e-20	71.3
LXL04_005110	`PF01315.28`	Ald_Xan_dh_C	605	709	2.2e-24	86.6
LXL04_005110	`PF02738.24`	MoCoBD_1	739	968	4.4e-79	265.7
LXL04_005110	`PF20256.4`	MoCoBD_2	997	1260	3e-69	234.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7G192`	Arabidopsis thaliana	Indole-3-acetaldehyde oxidase	60.149%	Swiss-Prot	strong database homology
`Q7G193`	Arabidopsis thaliana	Indole-3-acetaldehyde oxidase	60.221%	Swiss-Prot	strong database homology
`Q7G9P4`	Arabidopsis thaliana	Abscisic-aldehyde oxidase	59.377%	Swiss-Prot	strong database homology
`Q7G191`	Arabidopsis thaliana	Aldehyde oxidase 4	59.141%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card