LXL04_038456 | RubberDandelionOmics

Gene overview

LXL04_038456

Reference: OH-1004 Chr: Chr09 Coordinates: 41484509-41489694 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3051 bp · LXL04_038456|LXL04_038456|OH1004|cDNA

ATGAGTTTGGATTCTTCTCATCCAACCAAATCAGGATCCAATTCCAAGAGAAGCTTCAATTTGACAAATAGCAACAACACTGGTCGgaacaataataacaaaaggaagaggaagaaagagGGGGACAGTGGACAACAAACCCTAGGCATGGCTTGGGGTTCTAATTCTCGGTCTTCTTCTCGTTCCTCTTTTCGTAGTGCCCCGTTCACTGATGTTGGCAGTTATATGGCAGTAAAGAACAGGAAACTACATGAGCAATT...

CDS

Download CDS FASTA

3051 bp · LXL04_038456|LXL04_038456|OH1004|CDS

ATGAGTTTGGATTCTTCTCATCCAACCAAATCAGGATCCAATTCCAAGAGAAGCTTCAATTTGACAAATAGCAACAACACTGGTCGGAACAATAATAACAAAAGGAAGAGGAAGAAAGAGGGGGACAGTGGACAACAAACCCTAGGCATGGCTTGGGGTTCTAATTCTCGGTCTTCTTCTCGTTCCTCTTTTCGTAGTGCCCCGTTCACTGATGTTGGCAGTTATATGGCAGTAAAGAACAGGAAACTACATGAGCAATT...

Protein

Download Protein FASTA

1016 aa · LXL04_038456|LXL04_038456|OH1004|PROTEIN

MSLDSSHPTKSGSNSKRSFNLTNSNNTGRNNNNKRKRKKEGDSGQQTLGMAWGSNSRSSSRSSFRSAPFTDVGSYMAVKNRKLHEQFDAQASSSSHGGSGSKKPVFYGVSIFVDGYTVPSTQELRGYMLKHGGRFENYFSRQRVTHIICSNLPGSKVKNLRSFSRGLPVVKPTWILDCIAADKLLSWVPYQLEQIASEANNQPKLSTFLGLKSNMVSNDPANGPSTSDNNISEVSNSAEGVKQANQEFDFHMHDSFDEEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038456`
TK1151 ID	TkA04G431440
OH-1004 ID	LXL04_038456
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038456

Location Chr09:41484509-41489694 (-)

Description Similar to REV1: DNA repair protein REV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44750`	Deoxycytidyl transferase involved in DNA damage tolerance (DDT) and translesion synthesis (TLS).	AtREV1, a Y-family DNA polymerase in Arabidopsis, has deoxynucleotidyl transferase activity in vitro.2007 · DOI: 10.1104/pp.107.101980 Two translesion synthesis DNA polymerase genes, AtPOLH and AtREV1, are involved in development and UV light resistance in Arabidopsis.2008 · DOI: 10.1016/j.jplph.2007.11.012

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038456 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009411 response to UV Biological Process

GO:0010224 response to UV-B Biological Process

GO:0019985 translesion synthesis Biological Process

GO:0042276 error-prone translesion synthesis Biological Process

GO:0070987 error-free translesion synthesis Biological Process

GO:0071897 DNA biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT5G44750

gga:418703

mmu:56210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.912

Rank 1 · LXL04_038456 · OH-1004

Cytoplasm0.148

Rank 2 · LXL04_038456 · OH-1004

Mitochondrion0.041

Rank 3 · LXL04_038456 · OH-1004

Cell membrane0.021

Rank 4 · LXL04_038456 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_038456 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00533.34BRCT103-179 aa

PF16589.13BRCT_2104-190 aa

PF12738.14PTCB-BRCT109-174 aa

PF00817.26IMS454-528 aa

PF11798.15IMS_HHH540-571 aa

PF21999.3IMS_HHH_1555-605 aa

PF21704.4POLH-Rev1_HhH559-604 aa

PF11799.14IMS_C615-733 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038456	`PF00533.34`	BRCT	103	179	7.7e-11	42.8
LXL04_038456	`PF16589.13`	BRCT_2	104	190	1.2e-08	35.9
LXL04_038456	`PF12738.14`	PTCB-BRCT	109	174	5.6e-06	27.0
LXL04_038456	`PF00817.26`	IMS	454	528	2.7e-15	57.3
LXL04_038456	`PF11798.15`	IMS_HHH	540	571	3.5e-06	27.6
LXL04_038456	`PF21999.3`	IMS_HHH_1	555	605	1.9e-21	77.0
LXL04_038456	`PF21704.4`	POLH-Rev1_HhH	559	604	2.3e-06	28.4
LXL04_038456	`PF11799.14`	IMS_C	615	733	2.7e-19	70.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A3EWL3`	Arabidopsis thaliana	Translesion synthesis protein REV1	43.321%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card