LXL04_036480 | RubberDandelionOmics

Gene overview

LXL04_036480

Reference: OH-1004 Chr: Chr08 Coordinates: 43035508-43038379 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1749 bp · LXL04_036480|LXL04_036480|OH1004|cDNA

ATGGCCGACCATTTATGGCTTCTAATTGTTCTCTTATCTCTTTGTGCTATCTCTGTCTTGGGAGACGTGTTTGTAAGCATCGATTGCGGGGCTTCACGTTCTTTCACAGATGAAAACTCGATAGTTTGGAAAGGAGACGAAGATTTGATATCAAATGGTGTTTCCCATGAAGTACAATCAAACTACTCGATATCTCCTGTTATGGACACCTTGAGGGTTTTCACCACCCGTAAAAAGAACTGCTATTCTATAGAAGCAGA...

CDS

Download CDS FASTA

1749 bp · LXL04_036480|LXL04_036480|OH1004|CDS

ATGGCCGACCATTTATGGCTTCTAATTGTTCTCTTATCTCTTTGTGCTATCTCTGTCTTGGGAGACGTGTTTGTAAGCATCGATTGCGGGGCTTCACGTTCTTTCACAGATGAAAACTCGATAGTTTGGAAAGGAGACGAAGATTTGATATCAAATGGTGTTTCCCATGAAGTACAATCAAACTACTCGATATCTCCTGTTATGGACACCTTGAGGGTTTTCACCACCCGTAAAAAGAACTGCTATTCTATAGAAGCAGA...

Protein

Download Protein FASTA

582 aa · LXL04_036480|LXL04_036480|OH1004|PROTEIN

MADHLWLLIVLLSLCAISVLGDVFVSIDCGASRSFTDENSIVWKGDEDLISNGVSHEVQSNYSISPVMDTLRVFTTRKKNCYSIEAEKGGKVLVRASFNYGNYDQKSTPPIFDLHFDGNFWITVNTSEAKIYEAIYFVKMKVISVCVAQTRPGNFPFISSLEVRSVDSQVNRNVDTNYALFMNARFAYGTSETIRFPADAYDRIWNPALGNGLLNMKSEASVIDVDIPNNPPQEVLKHAIMAPNTSQMITLGLPIIDYPF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036480`
TK1151 ID	TkA04G042660
OH-1004 ID	LXL04_036480
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036480

Location Chr08:43035508-43038379 (-)

Description Similar to IOS1: LRR receptor-like serine/threonine-protein kinase IOS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51800`	Negatively regulates the abscisic acid (ABA) signaling pathway.	An Arabidopsis (malectin-like) leucine-rich repeat receptor-like kinase contributes to downy mildew disease.2011 · DOI: 10.1111/j.1365-3040.2011.02390.x The receptor kinase IMPAIRED OOMYCETE SUSCEPTIBILITY1 attenuates abscisic acid responses in Arabidopsis.2014 · DOI: 10.1104/pp.114.248518 The Arabidopsis Malectin-Like/LRR-RLK IOS1 Is Critical for BAK1-Dependent and BAK1-Independent Pattern-Triggered Immunity.2016 · DOI: 10.1105/tpc.16.00313
`At2g19210`	Putative leucine-rich repeat receptor-like protein kinase At2g19210.	No verified direct reference in this release
`At2g19230`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230.	No verified direct reference in this release
`At1g05700`	Probable LRR receptor-like serine/threonine-protein kinase At1g05700.	No verified direct reference in this release
`At2g19190`	Involved in innate immune response of plants.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036480 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010200 response to chitin Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT1G05700

ath:AT1G51800

ath:AT2G19190

ath:AT2G19210

ath:AT2G19230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.741

Rank 1 · LXL04_036480 · OH-1004

Extracellular0.103

Rank 2 · LXL04_036480 · OH-1004

Cytoplasm0.082

Rank 3 · LXL04_036480 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_036480 · OH-1004

Lysosome / Vacuole0.042

Rank 5 · LXL04_036480 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819.14Malectin_like27-342 aa

PF13855.13LRR_8395-453 aa

PF13855.13LRR_8419-476 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036480	`PF12819.14`	Malectin_like	27	342	4.3e-71	240.6
LXL04_036480	`PF13855.13`	LRR_8	395	453	3.7e-08	33.7
LXL04_036480	`PF13855.13`	LRR_8	419	476	3.7e-08	33.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8I6`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase IOS1	30.108%	Swiss-Prot	moderate database homology
`O65924`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like protein kinase At2g19210	31.629%	Swiss-Prot	moderate database homology
`O64556`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230	31.216%	Swiss-Prot	moderate database homology
`C0LGD6`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g05700	33.467%	Swiss-Prot	moderate database homology
`O64483`	Arabidopsis thaliana	Senescence-induced receptor-like serine/threonine-protein kinase	32.540%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card