RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G042660
Reference: TK1151 Chr: Chr04 Coordinates: 11439937-11443088 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2029 bp · TkA04G042660|TK1151|cDNA

CTAGTTCAATTCACCAACCAAGAGCATAAGGTCTCATTTCATCAGGCACCTTCTTCCTTCTCGTGTCCGTCCTCCATGGCCGACCATTTATGGCTTCTAATTGTTCTCTTATCTCTTTGTGCTATCTCTGTCTTGGGAGACGTGTTTGTAAGCATCGATTGCGGGGCTTCACGTTCTTTCACAGATGAAAACTCGATAGTTTGGACAGGAGACGAAGATTTGATATCAAATGGTGTTTCCCATGAAGTACAATCAAACTA...

CDS

Download CDS FASTA

1749 bp · TkA04G042660|TK1151|CDS

ATGGCCGACCATTTATGGCTTCTAATTGTTCTCTTATCTCTTTGTGCTATCTCTGTCTTGGGAGACGTGTTTGTAAGCATCGATTGCGGGGCTTCACGTTCTTTCACAGATGAAAACTCGATAGTTTGGACAGGAGACGAAGATTTGATATCAAATGGTGTTTCCCATGAAGTACAATCAAACTACTCGATATCTCCTGTTATGGACACCTTGAGGGTTTTCACCACCCGTAAAAAGAACTGCTATTCTATAGAAGCAGA...

Protein

Download Protein FASTA

582 aa · TkA04G042660|TK1151|PROTEIN

MADHLWLLIVLLSLCAISVLGDVFVSIDCGASRSFTDENSIVWTGDEDLISNGVSHEVQSNYSISPVMDTLRVFTTRKKNCYSIEAEKGGKVLVRASFNYGNYDQKSTPPIFDLHFDGNFWITVNTSEAKIYEAIYFVKMKVISVCVAQTRPGNFPFISSLEVRSVDSQVNRNVDTNYALFMNARFAYGTSETIRFPADAYDRIWNPALGNGLLNMKSEASVIDVDIPNNPPQEVLKHAIMAPNTSQMITLGLPIIDYPF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G042660
TK1151 IDTkA04G042660
OH-1004 IDLXL04_036480
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G042660
LocationChr04:11439937-11443088 (+)
DescriptionSimilar to IOS1: LRR receptor-like serine/threonine-protein kinase IOS1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g24485 Uncharacterized protein At1g24485. No verified direct reference in this release
At1g05700 Probable LRR receptor-like serine/threonine-protein kinase At1g05700. No verified direct reference in this release
At1g67720 Probable LRR receptor-like serine/threonine-protein kinase At1g67720. No verified direct reference in this release
At1g51860 Probable LRR receptor-like serine/threonine-protein kinase At1g51860. No verified direct reference in this release
At1g51800 Negatively regulates the abscisic acid (ABA) signaling pathway.
An Arabidopsis (malectin-like) leucine-rich repeat receptor-like kinase contributes to downy mildew disease.2011 · DOI: 10.1111/j.1365-3040.2011.02390.x
The receptor kinase IMPAIRED OOMYCETE SUSCEPTIBILITY1 attenuates abscisic acid responses in Arabidopsis.2014 · DOI: 10.1104/pp.114.248518
The Arabidopsis Malectin-Like/LRR-RLK IOS1 Is Critical for BAK1-Dependent and BAK1-Independent Pattern-Triggered Immunity.2016 · DOI: 10.1105/tpc.16.00313

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036480 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002229 defense response to oomycetes Biological Process
GO:0002237 response to molecule of bacterial origin Biological Process
GO:0002238 response to molecule of fungal origin Biological Process
GO:0002239 response to oomycetes Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009620 response to fungus Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010200 response to chitin Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:1900150 regulation of defense response to fungus Biological Process
GO:1900426 positive regulation of defense response to bacterium Biological Process
KEGG gene cross-reference
ath:AT1G05700
ath:AT1G51800
ath:AT2G19190
ath:AT2G19210
ath:AT2G19230
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.739
Rank 1 · TkA04G042660 · TK1151
Extracellular0.103
Rank 2 · TkA04G042660 · TK1151
Cytoplasm0.083
Rank 3 · TkA04G042660 · TK1151
Endoplasmic reticulum0.082
Rank 4 · TkA04G042660 · TK1151
Lysosome / Vacuole0.043
Rank 5 · TkA04G042660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819Malectin_like27-342 aa
PF18216N_formyltrans_C59-95 aa
PF12799LRR_4393-415 aa
PF13855LRR_8395-453 aa
PF00560LRR_1396-412 aa
PF13855LRR_8419-476 aa
PF00560LRR_1419-440 aa
PF12799LRR_4419-454 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G042660PF12819Malectin_like273421.6e-71242.0
TkA04G042660PF18216N_formyltrans_C59950.311.5
TkA04G042660PF12799LRR_43934152e-0525.4
TkA04G042660PF13855LRR_83954533.7e-0833.7
TkA04G042660PF00560LRR_13964121.8e-0524.6
TkA04G042660PF13855LRR_84194763.7e-0833.7
TkA04G042660PF00560LRR_14194401.8e-0524.6
TkA04G042660PF12799LRR_44194542e-0525.4
TkA04G042660PF00560LRR_14424621.8e-0524.6
TkA04G042660PF12799LRR_44614682e-0525.4
TkA04G042660PF00560LRR_14694811.8e-0524.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
A5PHT0Arabidopsis thalianasp|A5PHT0|Y1448_ARATH Uncharacterized protein At1g2448536.500%Swiss-ProtMedium
C0LGD6Arabidopsis thalianasp|C0LGD6|Y1570_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g0570031.800%Swiss-ProtMedium
C0LGI2Arabidopsis thalianasp|C0LGI2|Y1677_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g6772031.400%Swiss-ProtMedium
C0LGG4Arabidopsis thalianasp|C0LGG4|Y1518_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g5186029.300%Swiss-ProtLow
Q9C8I6Arabidopsis thalianasp|Q9C8I6|IOS1_ARATH LRR receptor-like serine/threonine-protein kinase IOS128.900%Swiss-ProtLow

JBrowse

View in Genome Browser