LXL04_030741 | RubberDandelionOmics

Gene overview

LXL04_030741

Reference: OH-1004 Chr: Chr06 Coordinates: 121828270-121830159 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1890 bp · LXL04_030741|LXL04_030741|OH1004|cDNA

ATGCATCCCGGAAGCCTCGCAATCATTCTTCTCTTCCTCCTATCGACACCCATCGCCGCCGTCGACTTCCTCTTCAACTCCTTCAACACCACCGCCGACCTCCTGTTAGTGCGTGACGCCCGCATCGAGCCACCGGCGATCCGCTTATCCAATGACTCCAATCAGTGGTCAATCGGTCGAGCTTTCTACTCACCGCGACTTCAAATGCTCCGGCAAGGCTCAGGTAACATTACTGTGTTCTCGACTCAGTTCGTATTTTC...

CDS

Download CDS FASTA

1890 bp · LXL04_030741|LXL04_030741|OH1004|CDS

ATGCATCCCGGAAGCCTCGCAATCATTCTTCTCTTCCTCCTATCGACACCCATCGCCGCCGTCGACTTCCTCTTCAACTCCTTCAACACCACCGCCGACCTCCTGTTAGTGCGTGACGCCCGCATCGAGCCACCGGCGATCCGCTTATCCAATGACTCCAATCAGTGGTCAATCGGTCGAGCTTTCTACTCACCGCGACTTCAAATGCTCCGGCAAGGCTCAGGTAACATTACTGTGTTCTCGACTCAGTTCGTATTTTC...

Protein

Download Protein FASTA

629 aa · LXL04_030741|LXL04_030741|OH1004|PROTEIN

MHPGSLAIILLFLLSTPIAAVDFLFNSFNTTADLLLVRDARIEPPAIRLSNDSNQWSIGRAFYSPRLQMLRQGSGNITVFSTQFVFSILPEISSSPGFGIAFVLSNTTEPSGAIGGQYLGLFSNRAARNVAPLIAVEFDTGINTELNETDGNHVGIDLNNIESEVKVGAGYYNSTGSLIPVDMRNGQNVHAWIEFDGSRTEINVTIAPAGMSKPIRPLLTYTNPAIANYISSDMYVGFSASKTTWIEAQRVLAWSFSDTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030741`
TK1151 ID	TkA07G427280
OH-1004 ID	LXL04_030741
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 71.065 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030741

Location Chr06:121828270-121830159 (-)

Description Similar to LECRKS1: L-type lectin-domain containing receptor kinase S.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15530`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At3g55550`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At4g29050`	L-type lectin-domain containing receptor kinase V.9.	No verified direct reference in this release
`At3g53810`	Required during pollen development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0531400`	Lectin-domain containing receptor kinase involved in salt stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030741 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0009555 pollen development Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1901001 negative regulation of response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G15530

ath:AT3G53810

ath:AT3G55550

ath:AT4G29050

dosa:Os04g0531400

osa:4336489

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.854

Rank 1 · LXL04_030741 · OH-1004

Endoplasmic reticulum0.086

Rank 2 · LXL04_030741 · OH-1004

Cytoplasm0.074

Rank 3 · LXL04_030741 · OH-1004

Nucleus0.041

Rank 4 · LXL04_030741 · OH-1004

Lysosome / Vacuole0.033

Rank 5 · LXL04_030741 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139.27Lectin_legB21-271 aa

PF00069.32Pkinase347-613 aa

PF07714.24PK_Tyr_Ser-Thr349-615 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030741	`PF00139.27`	Lectin_legB	21	271	1e-62	212.6
LXL04_030741	`PF00069.32`	Pkinase	347	613	6.4e-51	174.0
LXL04_030741	`PF07714.24`	PK_Tyr_Ser-Thr	349	615	6.5e-47	160.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9E0`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase S.1	61.513%	Swiss-Prot	strong database homology
`Q9M2S4`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase S.4	44.426%	Swiss-Prot	moderate database homology
`Q9SZD5`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase V.9	41.623%	Swiss-Prot	moderate database homology
`Q9M345`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IV.2	40.728%	Swiss-Prot	moderate database homology
`Q7XUN6`	Oryza sativa subsp. japonica	L-type lectin-domain containing receptor kinase SIT2	42.741%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card