TkA07G427280 | RubberDandelionOmics

Gene overview

TkA07G427280

Reference: TK1151 Chr: Chr07 Coordinates: 108092914-108094257 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1344 bp · TkA07G427280|TK1151|cDNA

ATGCGAAATGGGCAAAACGTACATGCTTGGATTGAATTCGATGGATCTAGAACGGAAATCAACGTTACAATTGCGCCGGCGGGTATGTCTAAACCAATCAGACCGTTACTCACTTATACCAATCCAGCTATTGCGAATTATATATCTTCTGATATGTATGTTGGATTTTCTGCTTCTAAAACAACTTGGATCGAAGCACAGAGGGTCCTCGCATGGAGTTTTAGCGACACCGGCGTTGCCAGAAACATCAATACCACCAA...

CDS

Download CDS FASTA

1344 bp · TkA07G427280|TK1151|CDS

ATGCGAAATGGGCAAAACGTACATGCTTGGATTGAATTCGATGGATCTAGAACGGAAATCAACGTTACAATTGCGCCGGCGGGTATGTCTAAACCAATCAGACCGTTACTCACTTATACCAATCCAGCTATTGCGAATTATATATCTTCTGATATGTATGTTGGATTTTCTGCTTCTAAAACAACTTGGATCGAAGCACAGAGGGTCCTCGCATGGAGTTTTAGCGACACCGGCGTTGCCAGAAACATCAATACCACCAA...

Protein

Download Protein FASTA

447 aa · TkA07G427280|TK1151|PROTEIN

MRNGQNVHAWIEFDGSRTEINVTIAPAGMSKPIRPLLTYTNPAIANYISSDMYVGFSASKTTWIEAQRVLAWSFSDTGVARNINTTNLPVFLPQSASNSGLSTGAKVGIVIGSVVFFLCVLGVCYFIWRKHHSRNEEDEIEDWELEYWPHRYSYEELKQSTNGFSDTEVLGAGGFGKVYKGTLPNKTLVAVKCINHDSKQGLREFMAEISSMGRLQHKNLVQMKGWCRKRNELLLVYDYMPNGSLNTWIFDKPKQILNWE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G427280`
TK1151 ID	TkA07G427280
OH-1004 ID	LXL04_030741
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 71.065 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G427280

Location Chr07:108092914-108094257 (-)

Description Similar to LECRKS1: L-type lectin-domain containing receptor kinase S.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15530`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At3g55550`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At2g37710`	L-type lectin-domain containing receptor kinase IV.1.	No verified direct reference in this release
`At3g53810`	Required during pollen development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0531400`	Lectin-domain containing receptor kinase involved in salt stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030741 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0009555 pollen development Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1901001 negative regulation of response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G15530

ath:AT3G53810

ath:AT3G55550

ath:AT4G29050

dosa:Os04g0531400

osa:4336489

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.856

Rank 1 · TkA07G427280 · TK1151

Cytoplasm0.087

Rank 2 · TkA07G427280 · TK1151

Endoplasmic reticulum0.084

Rank 3 · TkA07G427280 · TK1151

Nucleus0.048

Rank 4 · TkA07G427280 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA07G427280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139Lectin_legB2-89 aa

PF05808Podoplanin93-131 aa

PF29119F13C5_C108-131 aa

PF28423Epiregulin_C109-137 aa

PF00069Pkinase165-431 aa

PF03109ABC1166-204 aa

PF07714PK_Tyr_Ser-Thr167-433 aa

PF17667Pkinase_fungal265-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G427280	`PF00139`	Lectin_legB	2	89	4.6e-18	66.4
TkA07G427280	`PF05808`	Podoplanin	93	131	0.32	12.0
TkA07G427280	`PF29119`	F13C5_C	108	131	0.24	11.9
TkA07G427280	`PF28423`	Epiregulin_C	109	137	0.2	12.2
TkA07G427280	`PF00069`	Pkinase	165	431	2.8e-51	175.2
TkA07G427280	`PF03109`	ABC1	166	204	0.00091	19.2
TkA07G427280	`PF07714`	PK_Tyr_Ser-Thr	167	433	2.6e-47	162.0
TkA07G427280	`PF17667`	Pkinase_fungal	265	350	0.028	13.9
TkA07G427280	`PF03109`	ABC1	275	315	0.00091	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9E0`	Arabidopsis thaliana	sp\|Q9M9E0\|LRKS1_ARATH L-type lectin-domain containing receptor kinase S.1	66.100%	Swiss-Prot	High
`Q9M2S4`	Arabidopsis thaliana	sp\|Q9M2S4\|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4	47.900%	Swiss-Prot	Medium
`O80939`	Arabidopsis thaliana	sp\|O80939\|LRK41_ARATH L-type lectin-domain containing receptor kinase IV.1	45.300%	Swiss-Prot	Medium
`Q9M345`	Arabidopsis thaliana	sp\|Q9M345\|LRK42_ARATH L-type lectin-domain containing receptor kinase IV.2	43.400%	Swiss-Prot	Medium
`Q7XUN6`	Oryza sativa subsp. japonica	sp\|Q7XUN6\|SIT2_ORYSJ L-type lectin-domain containing receptor kinase SIT2	45.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card