LXL04_030701 | RubberDandelionOmics

Gene overview

LXL04_030701

Reference: OH-1004 Chr: Chr06 Coordinates: 121032354-121035983 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · LXL04_030701|LXL04_030701|OH1004|cDNA

ATGGTGCTAGAAATCGTGACATCTTTGGTGTTATTGTTTGTGGGTATTGCTGTTTTGGTGATAATTCATGTATGTTTAGCTGGAAGAAGATCATGGATGACTCAAGGAAGCAATGGGAGTAGTAATGAGGTGCGAAATAGTAGTACCATTTCAGAAGGTCATATAAAGAATCTTCCATGGTATGATTATCAAGAAGATAAAGTTGGAAAAGAAGTTGAGTGTGTTGTATGTTTGGAGGGTTTTAAGGGTGGTGATAAATG...

CDS

Download CDS FASTA

1086 bp · LXL04_030701|LXL04_030701|OH1004|CDS

ATGGTGCTAGAAATCGTGACATCTTTGGTGTTATTGTTTGTGGGTATTGCTGTTTTGGTGATAATTCATGTATGTTTAGCTGGAAGAAGATCATGGATGACTCAAGGAAGCAATGGGAGTAGTAATGAGGTGCGAAATAGTAGTACCATTTCAGAAGGTCATATAAAGAATCTTCCATGGTATGATTATCAAGAAGATAAAGTTGGAAAAGAAGTTGAGTGTGTTGTATGTTTGGAGGGTTTTAAGGGTGGTGATAAATG...

Protein

Download Protein FASTA

361 aa · LXL04_030701|LXL04_030701|OH1004|PROTEIN

MVLEIVTSLVLLFVGIAVLVIIHVCLAGRRSWMTQGSNGSSNEVRNSSTISEGHIKNLPWYDYQEDKVGKEVECVVCLEGFKGGDKCRLLPNCRHSFHVNCIDSWLMKTAVCPVCGNPDPGIQRGSDVRRILHRRLSPPSASAPFRLSPPSAPSFSSSDVRRFLLRGLPAFLNPRFLEFVNSPSVNEIDLHKISICEQRFVEVSNFKTFATPLSIAACIGQERFRAVTSAYYRGAVGALIVYDISRSTTFDSVSRWLEEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030701`
TK1151 ID	TkA07G424090
OH-1004 ID	LXL04_030701
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 92.742 / OH-1004 31.856 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030701

Location Chr06:121032354-121035983 (-)

Description Similar to RABA5C: Ras-related protein RABA5c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43130`	Intracellular vesicle trafficking and protein transport.	In vitro mutation analysis of Arabidopsis thaliana small GTP-binding proteins and detection of GAP-like activities in plant cells.1994 · DOI: 10.1016/0014-5793(94)80696-9
`At1g05810`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At2g31680`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At3g07410`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At5g47520`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030701 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0009408 response to heat Biological Process

GO:0048219 inter-Golgi cisterna vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0005798 Golgi-associated vesicle Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G05810

ath:AT2G31680

ath:AT2G43130

ath:AT3G07410

ath:AT5G47520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.305

Rank 1 · LXL04_030701 · OH-1004

Nucleus0.265

Rank 2 · LXL04_030701 · OH-1004

Endoplasmic reticulum0.230

Rank 3 · LXL04_030701 · OH-1004

Cell membrane0.149

Rank 4 · LXL04_030701 · OH-1004

Golgi apparatus0.135

Rank 5 · LXL04_030701 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_273-115 aa

PF17123.12zf-RING_1173-102 aa

PF13923.13zf-C3HC4_273-115 aa

PF12678.14zf-rbx182-115 aa

PF00071.29Ras208-268 aa

PF08477.20Roc213-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030701	`PF13639.13`	zf-RING_2	73	115	2.4e-12	47.6
LXL04_030701	`PF17123.12`	zf-RING_11	73	102	4.8e-10	39.7
LXL04_030701	`PF13923.13`	zf-C3HC4_2	73	115	7.9e-06	26.3
LXL04_030701	`PF12678.14`	zf-rbx1	82	115	5.8e-09	36.8
LXL04_030701	`PF00071.29`	Ras	208	268	9.4e-13	48.8
LXL04_030701	`PF08477.20`	Roc	213	264	1.1e-07	32.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P28187`	Arabidopsis thaliana	Ras-related protein RABA5c	83.333%	Swiss-Prot	weak database homology
`P19892`	Arabidopsis thaliana	Ras-related protein RABA5e	85.366%	Swiss-Prot	weak database homology
`Q9SIP0`	Arabidopsis thaliana	Ras-related protein RABA5d	85.366%	Swiss-Prot	weak database homology
`Q9SRS5`	Arabidopsis thaliana	Ras-related protein RABA5b	67.925%	Swiss-Prot	weak database homology
`Q9FGK5`	Arabidopsis thaliana	Ras-related protein RABA5a	66.038%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card