LXL04_027995 | RubberDandelionOmics

Gene overview

LXL04_027995

Reference: OH-1004 Chr: Chr06 Coordinates: 28330303-28334711 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2139 bp · LXL04_027995|LXL04_027995|OH1004|cDNA

ATGCCGGATTTGAGACGTGGAGTTCGCCAAGCTAAAAAAGCCATAAATcttgataataataataataataataataatgatgaGGTTGTTGTAGTAGCCCCTACAACACGTCGTGGGGCCCGCAGAGGTAGAGGTCAGGCACCAAAAGCACCTGCCCCAAATCCGATTCCAATGCCGAGGCCAGCTGGCAGAGGGAGAGGGGGTAGAGCAGGAATTGATCAAGATAAAAATGGTGAGATGTTTGGggcgggtggtggtgg...

CDS

Download CDS FASTA

2100 bp · LXL04_027995|LXL04_027995|OH1004|CDS

ATGCCGGATTTGAGACGTGGAGTTCGCCAAGCTAAAAAAGCCATAAATCTTGATAATAATAATAATAATAATAATAATGATGAGGTTGTTGTAGTAGCCCCTACAACACGTCGTGGGGCCCGCAGAGGTAGAGGTCAGGCACCAAAAGCACCTGCCCCAAATCCGATTCCAATGCCGAGGCCAGCTGGCAGAGGGAGAGGGGGTAGAGCAGGAATTGATCAAGATAAAAATGGTGAGATGTTTGGGGCGGGTGGTGGTGG...

Protein

Download Protein FASTA

699 aa · LXL04_027995|LXL04_027995|OH1004|PROTEIN

MPDLRRGVRQAKKAINLDNNNNNNNNDEVVVVAPTTRRGARRGRGQAPKAPAPNPIPMPRPAGRGRGGRAGIDQDKNGEMFGAGGGGGGRGPQLNLDVGIRDQLVVGKSAEKLVVNGEEEGSSSPVPERVQVGNSPAYKLERKLGKGGFGQVYVGRRVTGGSGIAGPDALEVALKLEHRNGKGCSYGPPYEWQVYSTLNGCYGLPMVHHKGRQGDYYILVMDKLGPSLWDVWNSSNQALSEEMVACIAVESLSILEQLHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027995`
TK1151 ID	TkA07G111410
OH-1004 ID	LXL04_027995
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027995

Location Chr06:28330303-28334711 (+)

Description Similar to HD16: Casein kinase 1-like protein HD16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03930`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At5g44100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0793500`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Hd16, a gene for casein kinase I, is involved in the control of rice flowering time by modulating the day-length response.2013 · DOI: 10.1111/tpj.12268

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027995 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0030111 regulation of Wnt signaling pathway Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT1G03930

ath:AT5G44100

cel:CELE_C03C10.1

dosa:Os03g0793500

pon:100172245

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.429

Rank 1 · LXL04_027995 · OH-1004

Nucleus0.419

Rank 2 · LXL04_027995 · OH-1004

Cell membrane0.117

Rank 3 · LXL04_027995 · OH-1004

Endoplasmic reticulum0.075

Rank 4 · LXL04_027995 · OH-1004

Plastid0.065

Rank 5 · LXL04_027995 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase138-424 aa

PF17667.8Pkinase_fungal219-347 aa

PF24289.2DUF7477432-699 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027995	`PF00069.32`	Pkinase	138	424	2.7e-16	60.5
LXL04_027995	`PF17667.8`	Pkinase_fungal	219	347	3.5e-06	26.7
LXL04_027995	`PF24289.2`	DUF7477	432	699	7.3e-153	508.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZWB3`	Arabidopsis thaliana	Casein kinase 1-like protein 9	40.283%	Swiss-Prot	weak database homology
`Q9FFH8`	Arabidopsis thaliana	Casein kinase 1-like protein 7	40.283%	Swiss-Prot	weak database homology
`Q852L0`	Oryza sativa subsp. japonica	Casein kinase 1-like protein HD16	75.966%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card