TkA07G111410 | RubberDandelionOmics

Gene overview

TkA07G111410

Reference: TK1151 Chr: Chr07 Coordinates: 28864841-28871340 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2952 bp · TkA07G111410|TK1151|cDNA

AGATGTTGAGGACTTGAGGCCGCACAACACAAAATCTTCTATTTGGCTATATGCTGCTGTAATAATGGAACGTTACAATCCCAGGCCTTACACCGTCTTTCCATGCGCCATATCTCTCACACATCGACCGCACACCCGCATCGACTCACCGACCGTCGTTTCTTTCTCTTATTTACTCATCCATATATAAATAAACCAACCCCATTTCATCAAAATACAATATTTTATCATCAATTTCATCTTTAGGGATTCCTTGATAA...

CDS

Download CDS FASTA

2106 bp · TkA07G111410|TK1151|CDS

ATGCCGGATTTGAGACGTGGAGTTCGCCAAGCTAAAAAAGCCATAAATCTTGATAATAATAATAATAATAATAATAATGATGAGGTTGTTGTAGTAGCCCCTACAACACGTCGTGGGGCCCGCAGAGGTAGAGGTCAGGCACCAAAAGCACCTGCCCCAAATCCGATTCCAATGCCGAGGCCAGCTGGCAGAGGGAGAGGGGGTAGAGCAGGAATTGATCAAGATAAAAATGGTGAGATGTTTGGGGCGGGTGGTGGTGG...

Protein

Download Protein FASTA

701 aa · TkA07G111410|TK1151|PROTEIN

MPDLRRGVRQAKKAINLDNNNNNNNNDEVVVVAPTTRRGARRGRGQAPKAPAPNPIPMPRPAGRGRGGRAGIDQDKNGEMFGAGGGGGGGGRGPQLNLDVGIRDQLVVGKSAEKLVVNGEEEGSSSPVPERVQVGNSPAYKLERKLGKGGFGQVYVGRRVTGGSGIAGPDALEVALKLEHRNGKGCSYGPPYEWQVYSTLNGCYGLPMVHHKGRQGDYYILVMDKLGPSLWDVWNSSNQALSEEMVACIAVESLSILEQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G111410`
TK1151 ID	TkA07G111410
OH-1004 ID	LXL04_027995
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G111410

Location Chr07:28864841-28871340 (+)

Description Similar to HD16: Casein kinase 1-like protein HD16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03930`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At5g44100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0793500`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Hd16, a gene for casein kinase I, is involved in the control of rice flowering time by modulating the day-length response.2013 · DOI: 10.1111/tpj.12268

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027995 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0030111 regulation of Wnt signaling pathway Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT1G03930

ath:AT5G44100

cel:CELE_C03C10.1

dosa:Os03g0793500

pon:100172245

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.432

Rank 1 · TkA07G111410 · TK1151

Nucleus0.418

Rank 2 · TkA07G111410 · TK1151

Cell membrane0.118

Rank 3 · TkA07G111410 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA07G111410 · TK1151

Plastid0.063

Rank 5 · TkA07G111410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase140-426 aa

PF07714PK_Tyr_Ser-Thr141-301 aa

PF24289DUF7477187-246 aa

PF17667Pkinase_fungal221-349 aa

PF03109ABC1227-299 aa

PF06293Kdo255-294 aa

PF24289DUF7477434-701 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G111410	`PF00069`	Pkinase	140	426	2.7e-16	60.5
TkA07G111410	`PF07714`	PK_Tyr_Ser-Thr	141	301	0.00012	22.2
TkA07G111410	`PF24289`	DUF7477	187	246	7.3e-153	508.0
TkA07G111410	`PF17667`	Pkinase_fungal	221	349	3.5e-06	26.7
TkA07G111410	`PF03109`	ABC1	227	299	0.0075	16.2
TkA07G111410	`PF06293`	Kdo	255	294	0.0027	17.9
TkA07G111410	`PF24289`	DUF7477	434	701	7.3e-153	508.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZWB3`	Arabidopsis thaliana	sp\|Q9ZWB3\|CKL9_ARATH Casein kinase 1-like protein 9	40.300%	Swiss-Prot	Low
`Q9FFH8`	Arabidopsis thaliana	sp\|Q9FFH8\|CKL7_ARATH Casein kinase 1-like protein 7	39.900%	Swiss-Prot	Low
`Q852L0`	Oryza sativa subsp. japonica	sp\|Q852L0\|HD16N_ORYSJ Casein kinase 1-like protein HD16	73.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card