Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1860 bp · LXL04_021152|LXL04_021152|OH1004|cDNA
ATGGCGTCAATGGCGATCTTAACTCGTAAATGGAAACCTCTATCCAAAACCATAAATCCCAAATTCATCACAAGCTACGCCTTTCTCTCACAAGAAGCTCAATTAGCCGAGCAACCACCATCGCCGCCACGGGTTTCCACCAGTCCACTACCACCGAACCCCGCGACAGGGAGCCCACTATACAATGAGAATTGGCGAAATCCTATCCCGAACATCTCCTCTTCAACCTCCCCCTCTCTTATCCCTCTGGGGTTTTCGCA...
1860 bp · LXL04_021152|LXL04_021152|OH1004|CDS
ATGGCGTCAATGGCGATCTTAACTCGTAAATGGAAACCTCTATCCAAAACCATAAATCCCAAATTCATCACAAGCTACGCCTTTCTCTCACAAGAAGCTCAATTAGCCGAGCAACCACCATCGCCGCCACGGGTTTCCACCAGTCCACTACCACCGAACCCCGCGACAGGGAGCCCACTATACAATGAGAATTGGCGAAATCCTATCCCGAACATCTCCTCTTCAACCTCCCCCTCTCTTATCCCTCTGGGGTTTTCGCA...
Protein
Download Protein FASTA619 aa · LXL04_021152|LXL04_021152|OH1004|PROTEIN
MASMAILTRKWKPLSKTINPKFITSYAFLSQEAQLAEQPPSPPRVSTSPLPPNPATGSPLYNENWRNPIPNISSSTSPSLIPLGFSQQHPSSRIEALSQTLDGDAIMNVFADWMTSQRWSDIKQLFEFWIRSLDNNGKPNKPDVSLYNHYLRANLMMGASAGELMDFVAQMEDYKISPNTASFNLVLKAMYQAKEFDAAVKLIDRMIQTGTESKTALPDDESYHLVVRLLLSRNQIDSALKYIDLTLKSGYMLSLEVFTE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021152 |
|---|---|
| TK1151 ID | TkA05G358130 |
| OH-1004 ID | LXL04_021152 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021152 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:122803168-122805459 (+) | ||||||||||||||||||
| Description | Similar to At1g26460: Pentatricopeptide repeat-containing protein At1g26460, mitochondrial | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0006413 translational initiation Biological Process GO:0009416 response to light stimulus Biological Process GO:0009555 pollen development Biological Process GO:0010207 photosystem II assembly Biological Process GO:0032544 plastid translation Biological Process GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function GO:0008494 translation activator activity Molecular Function | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT1G09900 ath:AT1G26460 ath:AT3G06920 ath:AT3G46610 ath:AT5G41170 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF29070.1MSC6_N114-243 aaPF23276.3TPR_24340-486 aaPF17177.11PPR_long441-543 aaPF29070.1MSC6_N476-544 aaPF13041.13PPR_2495-541 aaPF23276.3TPR_24511-575 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021152 | PF29070.1 | MSC6_N | 114 | 243 | 1.2e-14 | 55.0 |
| LXL04_021152 | PF23276.3 | TPR_24 | 340 | 486 | 5.3e-18 | 65.9 |
| LXL04_021152 | PF17177.11 | PPR_long | 441 | 543 | 5e-12 | 46.4 |
| LXL04_021152 | PF29070.1 | MSC6_N | 476 | 544 | 1.2e-14 | 55.0 |
| LXL04_021152 | PF13041.13 | PPR_2 | 495 | 541 | 1.5e-24 | 86.5 |
| LXL04_021152 | PF23276.3 | TPR_24 | 511 | 575 | 5.3e-18 | 65.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9FZD1 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At1g26460, mitochondrial | 60.995% | Swiss-Prot | strong database homology |
Q3EDF8 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At1g09900 | 20.650% | Swiss-Prot | weak database homology |
Q9SNB7 | Arabidopsis thaliana | Protein LOW PHOTOSYNTHETIC EFFICIENCY 1, chloroplastic | 21.903% | Swiss-Prot | weak database homology |
Q9FLL3 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At5g41170, mitochondrial | 22.654% | Swiss-Prot | weak database homology |
Q9M907 | Arabidopsis thaliana | Pentatricopeptide repeat-containing protein At3g06920 | 21.478% | Swiss-Prot | weak database homology |