LXL04_000083 | RubberDandelionOmics

Gene overview

LXL04_000083

Reference: OH-1004 Chr: Chr01 Coordinates: 1946228-1949243 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2946 bp · LXL04_000083|LXL04_000083|OH1004|cDNA

ATGTGGACGAAGACGACGCCGTTTCAAGTGATTGCTGCTGTTCTGTTGTTATTTTCGCCGGAGACGACGATTCTTCCGGTGTACTCTTTGAATGTAGCCCTTAACGACGACGTTTTGGGGCTTATGGTGTTTAAAGCAGACATACAAGACCCGTTCTTTAGACTGTCAACATGGAAGGAAGAAGACGACAGTGCTTGTTTATGGAGCGGAGTTACATGCGACCCGTATTCGAAGCGGGTAACGGAGCTCCATTTAGATGG...

CDS

Download CDS FASTA

2946 bp · LXL04_000083|LXL04_000083|OH1004|CDS

ATGTGGACGAAGACGACGCCGTTTCAAGTGATTGCTGCTGTTCTGTTGTTATTTTCGCCGGAGACGACGATTCTTCCGGTGTACTCTTTGAATGTAGCCCTTAACGACGACGTTTTGGGGCTTATGGTGTTTAAAGCAGACATACAAGACCCGTTCTTTAGACTGTCAACATGGAAGGAAGAAGACGACAGTGCTTGTTTATGGAGCGGAGTTACATGCGACCCGTATTCGAAGCGGGTAACGGAGCTCCATTTAGATGG...

Protein

Download Protein FASTA

981 aa · LXL04_000083|LXL04_000083|OH1004|PROTEIN

MWTKTTPFQVIAAVLLLFSPETTILPVYSLNVALNDDVLGLMVFKADIQDPFFRLSTWKEEDDSACLWSGVTCDPYSKRVTELHLDGFSLSGRISKGLLRLQFLQTLSLSRNNFTGLIGNPILSQLIKSLQVIDLSENGFFGSIPDQLFMECGSIRSLSLAKNKLTGQIPDAIASCSTLQNVDLSSNQLSGGLPNNIWYLTSLRSIDFSNNYLDGEIPHDKIETMFDLRVLNLSSNNFSGELPEKIGECLLLKSVDFSNN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000083`
TK1151 ID	TkA01G635940
OH-1004 ID	LXL04_000083
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000083

Location Chr01:1946228-1949243 (-)

Description Similar to IRK: Probable LRR receptor-like serine/threonine-protein kinase IRK

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56370`	Probable LRR receptor-like serine/threonine-protein kinase IRK.	No verified direct reference in this release
`At5g01890`	Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development.	No verified direct reference in this release
`At3g28040`	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040.	No verified direct reference in this release
`At1g12460`	Probable LRR receptor-like serine/threonine-protein kinase At1g12460.	No verified direct reference in this release
`At5g44700`	Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000083 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048364 root development Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0090511 periclinal cell division Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G12460

ath:AT3G28040

ath:AT3G56370

ath:AT5G01890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.865

Rank 1 · LXL04_000083 · OH-1004

Endoplasmic reticulum0.090

Rank 2 · LXL04_000083 · OH-1004

Cytoplasm0.062

Rank 3 · LXL04_000083 · OH-1004

Nucleus0.044

Rank 4 · LXL04_000083 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_000083 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_234-74 aa

PF13855.13LRR_8129-189 aa

PF23598.2LRR_14203-361 aa

PF13855.13LRR_8278-334 aa

PF13855.13LRR_8389-432 aa

PF23598.2LRR_14391-544 aa

PF13855.13LRR_8494-552 aa

PF07714.24PK_Tyr_Ser-Thr698-905 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000083	`PF08263.18`	LRRNT_2	34	74	1e-09	39.2
LXL04_000083	`PF13855.13`	LRR_8	129	189	1.1e-32	112.3
LXL04_000083	`PF23598.2`	LRR_14	203	361	6.6e-29	101.5
LXL04_000083	`PF13855.13`	LRR_8	278	334	1.1e-32	112.3
LXL04_000083	`PF13855.13`	LRR_8	389	432	1.1e-32	112.3
LXL04_000083	`PF23598.2`	LRR_14	391	544	6.6e-29	101.5
LXL04_000083	`PF13855.13`	LRR_8	494	552	1.1e-32	112.3
LXL04_000083	`PF07714.24`	PK_Tyr_Ser-Thr	698	905	8e-38	130.9
LXL04_000083	`PF00069.32`	Pkinase	698	904	2.9e-35	122.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LY03`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase IRK	57.380%	Swiss-Prot	strong database homology
`Q9LZV7`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase PXC2	57.413%	Swiss-Prot	strong database homology
`Q9LRT1`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	42.756%	Swiss-Prot	moderate database homology
`C0LGE4`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g12460	36.276%	Swiss-Prot	moderate database homology
`Q9FIZ3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO2	33.500%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card