Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1960 bp · TkAUNG098750|TK1151|cDNA
GAATCATTTGATTGTGGATCTAAAACCAAGTTTAACAATGAAGAAAACAATCAAGAGAAATTTAGTTTATCAGTCAAAGATTCGGACACAGTAGAATTAGAAGGTAAACAATCTAAAAAACTGGGAAAATCACGGTCACGAAGTGGTAAGATGGAATTCCCCATGGATTGTGGACCCGATGCTGAAGGTGATCACAATGGTCCAGGTGTTCCCTCATCCCGTGAAGAAAAAGTCAGCAGCCTCAAAACAGGCTTGGTTCA...
1809 bp · TkAUNG098750|TK1151|CDS
GAATCATTTGATTGTGGATCTAAAACCAAGTTTAACAATGAAGAAAACAATCAAGAGAAATTTAGTTTATCAGTCAAAGATTCGGACACAGTAGAATTAGAAGGTAAACAATCTAAAAAACTGGGAAAATCACGGTCACGAAGTGGTAAGATGGAATTCCCCATGGATTGTGGACCCGATGCTGAAGGTGATCACAATGGTCCAGGTGTTCCCTCATCCCGTGAAGAAAAAGTCAGCAGCCTCAAAACAGGCTTGGTTCA...
Protein
Download Protein FASTA602 aa · TkAUNG098750|TK1151|PROTEIN
ESFDCGSKTKFNNEENNQEKFSLSVKDSDTVELEGKQSKKLGKSRSRSGKMEFPMDCGPDAEGDHNGPGVPSSREEKVSSLKTGLVHVSRKMPKNAHVHFILGLMYQRMGQPQKAVAAYEKAEEILLRGEEDVDRPDLLSLVQTHHAQCILLGSSEDYGSGKELEGKELEEIIFKLNESMKYDVRQASVWNTLGVLLLKAGHLQIAISVLSSLLIVAPENLDCIGNLGMAHLQNGNLELSAKCFQDLILKDQNHPSVLIN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG098750 |
|---|---|
| TK1151 ID | TkAUNG098750 |
| OH-1004 ID | LXL04_009443 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 97.300 |
| Protein coverage (%) | TK1151 99.003 / OH-1004 90.840Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG098750 |
|---|---|
| Location | ChrUn:27873161-27876037 (+) |
| Description | Similar to TTC37: Tetratricopeptide repeat protein 37 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process GO:0006493 protein O-linked glycosylation Biological Process GO:0009736 cytokinin-activated signaling pathway Biological Process GO:0009740 gibberellic acid mediated signaling pathway Biological Process GO:0009908 flower development Biological Process GO:0009910 negative regulation of flower development Biological Process GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0030154 cell differentiation Biological Process GO:0036066 protein O-linked glycosylation via fucose Biological Process GO:0048511 rhythmic process Biological Process GO:0070478 nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay Biological Process |
| KEGG gene cross-reference | ath:AT3G04240 ath:AT3G11540 hsa:9652 mmu:218343 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04733Coatomer_E71-124 aaPF23914TPR_CcmH_CycH75-124 aaPF30990TTC22_N77-134 aaPF25064ARM_TT21_5th88-123 aaPF23300HEAT_Nup12089-143 aaPF29407CFAP70_TPR_C90-123 aaPF14559TPR_1991-122 aaPF12895ANAPC392-122 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG098750 | PF04733 | Coatomer_E | 71 | 124 | 0.02 | 15.1 |
| TkAUNG098750 | PF23914 | TPR_CcmH_CycH | 75 | 124 | 2.2e-15 | 57.6 |
| TkAUNG098750 | PF30990 | TTC22_N | 77 | 134 | 9.2e-11 | 42.6 |
| TkAUNG098750 | PF25064 | ARM_TT21_5th | 88 | 123 | 0.00036 | 21.6 |
| TkAUNG098750 | PF23300 | HEAT_Nup120 | 89 | 143 | 0.013 | 16.1 |
| TkAUNG098750 | PF29407 | CFAP70_TPR_C | 90 | 123 | 1.5e-14 | 54.8 |
| TkAUNG098750 | PF14559 | TPR_19 | 91 | 122 | 1.5e-15 | 58.0 |
| TkAUNG098750 | PF12895 | ANAPC3 | 92 | 122 | 0.011 | 16.8 |
| TkAUNG098750 | PF13431 | TPR_17 | 93 | 116 | 1.5e-21 | 75.5 |
| TkAUNG098750 | PF13432 | TPR_16 | 93 | 123 | 6.1e-20 | 72.0 |
| TkAUNG098750 | PF13414 | TPR_11 | 93 | 110 | 3e-11 | 43.5 |
| TkAUNG098750 | PF13181 | TPR_8 | 96 | 125 | 9.1e-29 | 97.8 |
| TkAUNG098750 | PF13424 | TPR_12 | 96 | 126 | 5.2e-21 | 75.3 |
| TkAUNG098750 | PF21033 | RMD1-3 | 96 | 132 | 0.019 | 14.9 |
| TkAUNG098750 | PF07721 | TPR_4 | 96 | 120 | 0.29 | 12.6 |
| TkAUNG098750 | PF07719 | TPR_2 | 97 | 125 | 2.7e-32 | 108.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.