LXL04_009443 | RubberDandelionOmics

Gene overview

LXL04_009443

Reference: OH-1004 Chr: Chr02 Coordinates: 126686029-126689367 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1968 bp · LXL04_009443|LXL04_009443|OH1004|cDNA

ATGTCCCAACCGCCGGTTCCTAACCATACAGCCGGCGACCATACAAAATCTCAACTCTCCTCCGTCACCACCATCACTGCAGAAGAAAGCTTCAAAGCGCCGTCAAGACCGCATCCCCCTAAAATAGTAGTGCTAGCTGACCTCAACGTTGACCCTCCTACTGATACGGACGCCCTCGATTCTTCTCCCAGGTTTAACAATGAAGAAAACAATCAAGAGAAATTTAGTTTATCAGTCAAAGATTCGGACACAGTAGAATT...

CDS

Download CDS FASTA

1968 bp · LXL04_009443|LXL04_009443|OH1004|CDS

ATGTCCCAACCGCCGGTTCCTAACCATACAGCCGGCGACCATACAAAATCTCAACTCTCCTCCGTCACCACCATCACTGCAGAAGAAAGCTTCAAAGCGCCGTCAAGACCGCATCCCCCTAAAATAGTAGTGCTAGCTGACCTCAACGTTGACCCTCCTACTGATACGGACGCCCTCGATTCTTCTCCCAGGTTTAACAATGAAGAAAACAATCAAGAGAAATTTAGTTTATCAGTCAAAGATTCGGACACAGTAGAATT...

Protein

Download Protein FASTA

655 aa · LXL04_009443|LXL04_009443|OH1004|PROTEIN

MSQPPVPNHTAGDHTKSQLSSVTTITAEESFKAPSRPHPPKIVVLADLNVDPPTDTDALDSSPRFNNEENNQEKFSLSVKDSDTVELEGKQSKKLGKSRSRSGKMEFPMDCGPDAEGDHNGPGVPSSREEKVSSLKTGLVHVSRKMPKNAHVHFILGLMYQRMGQPQKAVAAYEKAEEILLRGEEDVDRPDLLSLVQTHHAQCILLGSSEDYGSGKELEGKELEEIIFKLNESMKYDVRQASVWNTLGVLLLKAGHLQNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009443`
TK1151 ID	TkAUNG098750
OH-1004 ID	LXL04_009443
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.300
Protein coverage (%)	TK1151 99.003 / OH-1004 90.840 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009443

Location Chr02:126686029-126689367 (-)

Description Similar to TTC37: Tetratricopeptide repeat protein 37

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04240`	O-linked N-acetylglucosamine transferase (OGT) that mediates O-glycosylation of capsid protein (CP) of virus in case of infection by Plum pox virus.	No verified direct reference in this release
`At3g11540`	Probable O-linked N-acetylglucosamine transferase (OGT) involved in various processes such as gibberellin (GA) signaling pathway and circadian clock.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009443 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process

GO:0006493 protein O-linked glycosylation Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

GO:0036066 protein O-linked glycosylation via fucose Biological Process

GO:0048511 rhythmic process Biological Process

GO:0070478 nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay Biological Process

KEGG gene cross-reference

ath:AT3G04240

ath:AT3G11540

hsa:9652

mmu:218343

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.634

Rank 1 · LXL04_009443 · OH-1004

Cytoplasm0.297

Rank 2 · LXL04_009443 · OH-1004

Cell membrane0.061

Rank 3 · LXL04_009443 · OH-1004

Golgi apparatus0.055

Rank 4 · LXL04_009443 · OH-1004

Endoplasmic reticulum0.049

Rank 5 · LXL04_009443 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07719.24TPR_2151-179 aa

PF00515.35TPR_1152-179 aa

PF14559.13TPR_19251-311 aa

PF29386.1CFAP70_mid_TPR545-638 aa

PF29407.1CFAP70_TPR_C547-633 aa

PF13424.13TPR_12566-629 aa

PF13181.13TPR_8568-598 aa

PF00515.35TPR_1569-599 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009443	`PF07719.24`	TPR_2	151	179	2.5e-33	112.1
LXL04_009443	`PF00515.35`	TPR_1	152	179	9.1e-35	117.8
LXL04_009443	`PF14559.13`	TPR_19	251	311	2.7e-18	66.8
LXL04_009443	`PF29386.1`	CFAP70_mid_TPR	545	638	2.6e-13	51.1
LXL04_009443	`PF29407.1`	CFAP70_TPR_C	547	633	6.9e-16	59.2
LXL04_009443	`PF13424.13`	TPR_12	566	629	2.8e-24	85.8
LXL04_009443	`PF13181.13`	TPR_8	568	598	7.2e-32	107.5
LXL04_009443	`PF00515.35`	TPR_1	569	599	9.1e-35	117.8
LXL04_009443	`PF07719.24`	TPR_2	569	598	2.5e-33	112.1
LXL04_009443	`PF13371.13`	TPR_9	572	642	3.1e-15	56.7
LXL04_009443	`PF13414.13`	TPR_11	573	610	2.1e-13	50.4
LXL04_009443	`PF14559.13`	TPR_19	578	631	2.7e-18	66.8
LXL04_009443	`PF13431.13`	TPR_17	589	620	5.3e-22	76.9
LXL04_009443	`PF00515.35`	TPR_1	600	631	9.1e-35	117.8
LXL04_009443	`PF07719.24`	TPR_2	600	631	2.5e-33	112.1
LXL04_009443	`PF13181.13`	TPR_8	600	631	7.2e-32	107.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8Y0`	Arabidopsis thaliana	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC	23.684%	Swiss-Prot	weak database homology
`Q96301`	Arabidopsis thaliana	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY	24.129%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card