RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G006880
Reference: TK1151 Chr: Chr07 Coordinates: 1909456-1918567 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1333 bp · TkA07G006880|TK1151|cDNA

TGCATATCTAAAGGGCCACCTCTATTACCCCACGCTAGCACTATATATAATCTTGTTCATTTAATGGATATAGTGAAGCTTCAAAAGACCTACAAGCTCTTGAATTCCCTCATAAACCCCAGAAATTAAGACTGGAATTTGTGTGATCAGCAATGGTGGCATTTGGGAAAAAGTTGAAGGAATTGCAGATCCAGGAATGGAAAGGATATTACATTGATTACAAGTTACTCAAGAAGAAAGTAAAGCAATACGCTCAACAA...

CDS

Download CDS FASTA

2103 bp · TkA07G006880|TK1151|CDS

ATGGTGGCATTTGGGAAAAAGTTGAAGGAATTGCAGATCCAGGAATGGAAAGGATATTACATTGATTACAAGTTACTCAAGAAGAAAGTAAAGCAATACGCTCAACAAAAGGACGATGTAGTCCACGATCGCGATTACGTTCTACGCGATTTCTCCAAATTGCTCGATGAACAGATTGAGAAGGTAGTTCTGTTCTTACTGAAGCGACAAGGTCAACTTGCGACTAGGTTATCAGGTCTTGCTGACAATGGCGACGAGAG...

Protein

Download Protein FASTA

700 aa · TkA07G006880|TK1151|PROTEIN

MVAFGKKLKELQIQEWKGYYIDYKLLKKKVKQYAQQKDDVVHDRDYVLRDFSKLLDEQIEKVVLFLLKRQGQLATRLSGLADNGDESLSHGRDHDSIVELREGYREVGRDLLRLLFFVEMNAIGLRKILKKFDKRFGYKFTNYYVKTRANHPYSQLRQVFKHVGISAVVGSISRNIADLKDDQTHYASIYDHPTLHISDPIIESIKSAENRLLNSTDFLHYLGKHAFIVQDNEFPFPETSPQENNMNERYHFMSLVLNLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G006880
TK1151 IDTkA07G006880
OH-1004 IDLXL04_026776
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)99.600
Protein coverage (%)TK1151 95.714 / OH-1004 70.675
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G006880
LocationChr07:1909456-1918567 (+)
DescriptionSimilar to At4g22990: SPX domain-containing membrane protein At4g22990
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g22990 SPX domain-containing membrane protein At4g22990. No verified direct reference in this release
At4g11810 SPX domain-containing membrane protein At4g11810. No verified direct reference in this release
At1g63010 SPX domain-containing membrane protein At1g63010. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8AT51 SPX domain-containing membrane protein OsI_17046. No verified direct reference in this release
Os04g0573000 SPX domain-containing membrane protein Os04g0573000. No verified direct reference in this release
UniProt: A2Y8U6 SPX domain-containing membrane protein OsI_21475. No verified direct reference in this release
Os06g0129400 SPX domain-containing membrane protein Os06g0129400. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026776 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006817 phosphate ion transport Biological Process
GO:1905011 transmembrane phosphate ion transport from cytosol to vacuole Biological Process
GO:0009705 plant-type vacuole membrane Cellular Component
GO:0016020 membrane Cellular Component
GO:0005315 phosphate transmembrane transporter activity Molecular Function
GO:0022857 transmembrane transporter activity Molecular Function
KEGG gene cross-reference
ath:AT4G11810
ath:AT4G22990
dosa:Os02g0678200
dosa:Os04g0573000
osa:4336724
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.366
Rank 1 · TkA07G006880 · TK1151
Golgi apparatus0.237
Rank 2 · TkA07G006880 · TK1151
Endoplasmic reticulum0.199
Rank 3 · TkA07G006880 · TK1151
Cytoplasm0.196
Rank 4 · TkA07G006880 · TK1151
Cell membrane0.169
Rank 5 · TkA07G006880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03105SPX4-37 aa
PF03105SPX49-82 aa
PF03105SPX109-147 aa
PF18735HEPN_RiboL-PSP125-167 aa
PF07690MFS_1260-633 aa
PF00083Sugar_tr266-426 aa
PF23417STING_TM295-336 aa
PF23417STING_TM401-447 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G006880PF03105SPX4374.9e-1350.6
TkA07G006880PF03105SPX49824.9e-1350.6
TkA07G006880PF03105SPX1091474.9e-1350.6
TkA07G006880PF18735HEPN_RiboL-PSP1251670.06713.8
TkA07G006880PF07690MFS_12606332.1e-1867.1
TkA07G006880PF00083Sugar_tr2664263.6e-0626.9
TkA07G006880PF23417STING_TM2953360.9310.6
TkA07G006880PF23417STING_TM4014470.9310.6
TkA07G006880PF23417STING_TM5365700.9310.6
TkA07G006880PF00083Sugar_tr5596193.6e-0626.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93ZQ5Arabidopsis thalianasp|Q93ZQ5|SPXM3_ARATH SPX domain-containing membrane protein At4g2299067.500%Swiss-ProtHigh
Q9T050Arabidopsis thalianasp|Q9T050|SPXM2_ARATH SPX domain-containing membrane protein At4g1181065.000%Swiss-ProtHigh
Q2V4F9Arabidopsis thalianasp|Q2V4F9|SPXM1_ARATH SPX domain-containing membrane protein At1g6301065.600%Swiss-ProtHigh
B8AT51Oryza sativa subsp. indicasp|B8AT51|SPXM2_ORYSI SPX domain-containing membrane protein OsI_1704664.600%Swiss-ProtHigh
Q0JAW2Oryza sativa subsp. japonicasp|Q0JAW2|SPXM2_ORYSJ SPX domain-containing membrane protein Os04g057300064.600%Swiss-ProtHigh
A2Y8U6Oryza sativa subsp. indicasp|A2Y8U6|SPXM3_ORYSI SPX domain-containing membrane protein OsI_2147564.400%Swiss-ProtHigh
Q658H5Oryza sativa subsp. japonicasp|Q658H5|SPXM3_ORYSJ SPX domain-containing membrane protein Os06g012940064.400%Swiss-ProtHigh

JBrowse

View in Genome Browser