TkA06G070390 | RubberDandelionOmics

Gene overview

TkA06G070390

Reference: TK1151 Chr: Chr06 Coordinates: 18858673-18862310 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1801 bp · TkA06G070390|TK1151|cDNA

GGAAAATTGGTTGTATTTGTCGTGCTTATTGAATTGTACGGTACGACCTCAGTAGGCATTGGTAGAAAGATAATACGGTGACCCGGACGTTGAAACTTGAAGTTATGCAAGAAGGTTCTTGTATCTCCAACGGAGCTGAAGACCCATAAGAACTTAGAAGATTTAAGTCAAAATTCACGATTCCCGCTTGCGAACAGAGATCGAAACCTTCAGCTCATATGCTATTCTGAAGCTTTTGATCCAGAAAACACAGCCCTACC...

CDS

Download CDS FASTA

873 bp · TkA06G070390|TK1151|CDS

ATGGCGAGATGGTCTTGCGATTTCAGATACCTTCTTGTCCTTGTTGTACTCGCATTCATATATACCCAGGTGAAGCTGTTTACCACTGAATCTGAGTACGTCGATGCACTTGAAACTGCAGTGGAAGCAGAAAATCGTTGCAGGAATAAAATGCGGTTGCTAATTGATGAAATCAGCATGAATCAGGAAAATATTGTGGTTTTGAAAGAAAAAGTAAAACTCCAAGAAAAGGAATGTGAATATCTGAGGACACTTGTTCA...

Protein

Download Protein FASTA

290 aa · TkA06G070390|TK1151|PROTEIN

MARWSCDFRYLLVLVVLAFIYTQVKLFTTESEYVDALETAVEAENRCRNKMRLLIDEISMNQENIVVLKEKVKLQEKECEYLRTLVQKLEKKGVKSLTREEQVPVAAVVIMACNRADYLERTIKSILKYHSSVASKFPVFVSQDGSNSDVREKAMTYGQLNYMQHLDYKPVHTERPGELIAYYKIARHYKWALDQLFYQHNFNRVIILEDDMEISPDFFDYFEAGAGLLDKDKSIMAISSWNDNGQKQYVHDPYMLYRSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G070390`
TK1151 ID	TkA06G070390
OH-1004 ID	LXL04_009718
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	80.500
Protein coverage (%)	TK1151 97.241 / OH-1004 66.825 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G070390

Location Chr06:18858673-18862310 (-)

Description Similar to GNTI: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38240`	Initiates complex N-linked carbohydrate formation.	Salt tolerance of Arabidopsis thaliana requires maturation of N-glycosylated proteins in the Golgi apparatus.2008 · DOI: 10.1073/pnas.0800237105 Comparative analyses of Arabidopsis complex glycan1 mutants and genetic interaction with staurosporin and temperature sensitive3a.2008 · DOI: 10.1104/pp.108.127027

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009718 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006013 mannose metabolic process Biological Process

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006491 N-glycan processing Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0019082 viral protein processing Biological Process

GO:0033499 galactose catabolic process via UDP-galactose, Leloir pathway Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT4G38240

hsa:4245

mmu:17308

ocu:100009521

rno:81519

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.738

Rank 1 · TkA06G070390 · TK1151

Endoplasmic reticulum0.186

Rank 2 · TkA06G070390 · TK1151

Cytoplasm0.098

Rank 3 · TkA06G070390 · TK1151

Extracellular0.062

Rank 4 · TkA06G070390 · TK1151

Cell membrane0.055

Rank 5 · TkA06G070390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12234Rav1p_C12-111 aa

PF03071GNT-I16-283 aa

PF08336P4Ha_N24-64 aa

PF12302DUF362928-80 aa

PF13641Glyco_tranf_2_331-45 aa

PF27823SCD2_helical_N54-98 aa

PF08336P4Ha_N60-101 aa

PF18504Csm1_N62-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G070390	`PF12234`	Rav1p_C	12	111	0.093	11.8
TkA06G070390	`PF03071`	GNT-I	16	283	1.8e-104	350.7
TkA06G070390	`PF08336`	P4Ha_N	24	64	0.6	10.6
TkA06G070390	`PF12302`	DUF3629	28	80	0.036	14.2
TkA06G070390	`PF13641`	Glyco_tranf_2_3	31	45	0.13	12.6
TkA06G070390	`PF27823`	SCD2_helical_N	54	98	0.063	14.2
TkA06G070390	`PF08336`	P4Ha_N	60	101	0.6	10.6
TkA06G070390	`PF18504`	Csm1_N	62	102	0.25	12.4
TkA06G070390	`PF01755`	Glyco_transf_25	63	94	0.087	13.4
TkA06G070390	`PF11598`	COMP	67	87	0.13	13.4
TkA06G070390	`PF20216`	DUF6576	85	102	0.24	12.3
TkA06G070390	`PF13641`	Glyco_tranf_2_3	106	156	0.13	12.6
TkA06G070390	`PF00535`	Glycos_transf_2	108	189	5.8e-05	23.8
TkA06G070390	`PF01755`	Glyco_transf_25	197	224	0.087	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XGM8`	Arabidopsis thaliana	sp\|Q9XGM8\|MGAT1_ARATH Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase	66.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card