LXL04_009718 | RubberDandelionOmics

Gene overview

LXL04_009718

Reference: OH-1004 Chr: Chr02 Coordinates: 132127098-132131113 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1269 bp · LXL04_009718|LXL04_009718|OH1004|cDNA

ATGGCGAGATGGACTAGCGGATTTAGATTTTTGCTTCTTCTCGTTGCAATCGCATTCATCTATACCCAGGTGAGGCTGTTTAAGGCACAATCTGAGTATGCTGACAGAGTTGCAGTTGCAGTGGAAGGGGAAAATCATTGTACGGGTCAGATGCGGTTACTGATTGATGAGATAAGTATGCAGAGGGAAAGAGTGGTTATTTTGGAAGAAAAATTGAGACGCCAAGAAGAGGAGTGTGAACAATTGAGGACACatgttca...

CDS

Download CDS FASTA

1269 bp · LXL04_009718|LXL04_009718|OH1004|CDS

ATGGCGAGATGGACTAGCGGATTTAGATTTTTGCTTCTTCTCGTTGCAATCGCATTCATCTATACCCAGGTGAGGCTGTTTAAGGCACAATCTGAGTATGCTGACAGAGTTGCAGTTGCAGTGGAAGGGGAAAATCATTGTACGGGTCAGATGCGGTTACTGATTGATGAGATAAGTATGCAGAGGGAAAGAGTGGTTATTTTGGAAGAAAAATTGAGACGCCAAGAAGAGGAGTGTGAACAATTGAGGACACATGTTCA...

Protein

Download Protein FASTA

422 aa · LXL04_009718|LXL04_009718|OH1004|PROTEIN

MARWTSGFRFLLLLVAIAFIYTQVRLFKAQSEYADRVAVAVEGENHCTGQMRLLIDEISMQRERVVILEEKLRRQEEECEQLRTHVQNLERKGVKNLFQQVKAPVAAVVIMACNRADYLERTIDSILKYHGSVASKFPVFVSQDGSNSDVRTKAMSYSQLTYMQHLDYEPVVTERPGELIAYYKIARHYKWALDQLFYSHNFNRVIILEDDMEISPDFFDYFEAGADLLDKDKSIMAISSWNDNGQKQFVHDPYALYRSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009718`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009718

Location Chr02:132127098-132131113 (-)

Description Similar to GNTI: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38240`	Initiates complex N-linked carbohydrate formation.	Salt tolerance of Arabidopsis thaliana requires maturation of N-glycosylated proteins in the Golgi apparatus.2008 · DOI: 10.1073/pnas.0800237105 Comparative analyses of Arabidopsis complex glycan1 mutants and genetic interaction with staurosporin and temperature sensitive3a.2008 · DOI: 10.1104/pp.108.127027

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009718 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006013 mannose metabolic process Biological Process

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006491 N-glycan processing Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0019082 viral protein processing Biological Process

GO:0033499 galactose catabolic process via UDP-galactose, Leloir pathway Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT4G38240

hsa:4245

mmu:17308

ocu:100009521

rno:81519

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.572

Rank 1 · LXL04_009718 · OH-1004

Endoplasmic reticulum0.350

Rank 2 · LXL04_009718 · OH-1004

Cytoplasm0.117

Rank 3 · LXL04_009718 · OH-1004

Nucleus0.061

Rank 4 · LXL04_009718 · OH-1004

Extracellular0.060

Rank 5 · LXL04_009718 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03071.22GNT-I16-285 aa

PF03071.22GNT-I310-421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009718	`PF03071.22`	GNT-I	16	285	2.1e-141	472.4
LXL04_009718	`PF03071.22`	GNT-I	310	421	2.1e-141	472.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XGM8`	Arabidopsis thaliana	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase	61.851%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card