TkA06G006310 | RubberDandelionOmics

Gene overview

TkA06G006310

Reference: TK1151 Chr: Chr06 Coordinates: 1582268-1585339 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2452 bp · TkA06G006310|TK1151|cDNA

ATCCTATAGAGGTGGAAGGATGCAATGCGGTTTTTTGGTAGAAATACAGTACAGTTGACATCATCTATACGCAATCAGAAAAGAAAGTCATATCGGATCTAACGGTAAATGATTGACTATGTACAGAAATTGGTCCAGCAAAAAGCACACTTTTCTATTACTTCTCTCCTCTCCTCTCCTCTCCTCAGTCCATCACTCCCTCTGTCCCTCACACTGTCCTTCTTTGACATTTCTCCTTTTGTTCATACCTCCAAATTCAA...

CDS

Download CDS FASTA

1383 bp · TkA06G006310|TK1151|CDS

ATGCTTCATCTTTCCTCCCTCTTTCTGGCTGTAATATTCTGTTTATACCCAATTTTCTGTTATGGAAATGCAGAGGTTAGTGTTCTTATGGAGATCAAGGCTTCCCTGGACCCCGAAAACAAGCACCTTACTTCATGGACGGAAACCGGCGATCCTTGCAGCGGTTCATTTCTCGGTGTCGCTTGTAACCAGTATCTGAAAGTAGCTAACATCTCCTTACAAGGCAAAGGGCTCACCGGAAAACTCTCTCCAGCCATTTC...

Protein

Download Protein FASTA

460 aa · TkA06G006310|TK1151|PROTEIN

MLHLSSLFLAVIFCLYPIFCYGNAEVSVLMEIKASLDPENKHLTSWTETGDPCSGSFLGVACNQYLKVANISLQGKGLTGKLSPAISGLKCLSGLYLHYNFLTGEIPAEISSLNELSELYLNVNNLTGEIPQEIGSMTGLQVMELCCNKLTGTIPPELGNLKKLNVVALQHNRLTGQIPRTLGDLAVLERLDLSFNRLLGTIPINIARVTQLEFFDVQNNTLSGFVPTGLKRLNSGFNYNNNQDLCGAAFSSLRPCTDLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G006310`
TK1151 ID	TkA06G006310
OH-1004 ID	LXL04_026543
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.913 / OH-1004 68.012 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G006310

Location Chr06:1582268-1585339 (+)

Description Similar to IRK: Probable LRR receptor-like serine/threonine-protein kinase IRK

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11050`	Probable receptor-like protein kinase At1g11050.	No verified direct reference in this release
`At5g63710`	Probable LRR receptor-like serine/threonine-protein kinase At5g63710.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0637800`	Receptor protein kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026543 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048364 root development Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0090511 periclinal cell division Biological Process

GO:1901653 cellular response to peptide Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G25560

ath:AT3G56370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.849

Rank 1 · TkA06G006310 · TK1151

Endoplasmic reticulum0.084

Rank 2 · TkA06G006310 · TK1151

Cytoplasm0.074

Rank 3 · TkA06G006310 · TK1151

Nucleus0.051

Rank 4 · TkA06G006310 · TK1151

Lysosome / Vacuole0.026

Rank 5 · TkA06G006310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21314TM_ErbB16-15 aa

PF08263LRRNT_223-63 aa

PF00560LRR_171-89 aa

PF23598LRR_1480-171 aa

PF13855LRR_885-126 aa

PF00560LRR_192-113 aa

PF12799LRR_494-128 aa

PF29252LRR_NLRC4104-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G006310	`PF21314`	TM_ErbB1	6	15	2.2	8.8
TkA06G006310	`PF08263`	LRRNT_2	23	63	1.5e-08	35.4
TkA06G006310	`PF00560`	LRR_1	71	89	9.6e-18	61.2
TkA06G006310	`PF23598`	LRR_14	80	171	1e-12	48.3
TkA06G006310	`PF13855`	LRR_8	85	126	1.5e-13	51.0
TkA06G006310	`PF00560`	LRR_1	92	113	9.6e-18	61.2
TkA06G006310	`PF12799`	LRR_4	94	128	2.7e-09	37.7
TkA06G006310	`PF29252`	LRR_NLRC4	104	176	0.12	12.3
TkA06G006310	`PF00560`	LRR_1	116	137	9.6e-18	61.2
TkA06G006310	`PF24141`	LRR_ComC	122	203	0.0074	16.7
TkA06G006310	`PF13855`	LRR_8	139	198	1.5e-13	51.0
TkA06G006310	`PF12799`	LRR_4	139	174	2.7e-09	37.7
TkA06G006310	`PF00560`	LRR_1	140	161	9.6e-18	61.2
TkA06G006310	`PF00560`	LRR_1	164	185	9.6e-18	61.2
TkA06G006310	`PF23598`	LRR_14	176	235	1e-12	48.3
TkA06G006310	`PF00560`	LRR_1	188	207	9.6e-18	61.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04086`	Arabidopsis thaliana	sp\|O04086\|Y1105_ARATH Probable receptor-like protein kinase At1g11050	47.800%	Swiss-Prot	Low
`Q8W4S5`	Arabidopsis thaliana	sp\|Q8W4S5\|Y5371_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g63710	36.800%	Swiss-Prot	Low
`Q75J39`	Oryza sativa subsp. japonica	sp\|Q75J39\|CKI4_ORYSJ Serine/threonine-protein kinase-like protein CR4	45.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card