LXL04_026543 | RubberDandelionOmics

Gene overview

LXL04_026543

Reference: OH-1004 Chr: Chr05 Coordinates: 127988744-127991556 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2189 bp · LXL04_026543|LXL04_026543|OH1004|cDNA

ATGATTGACTATGTACAGAAAttggtccagcaaaaagcacACTTTTCTATTACTTCTCTCCTCTCCTCTCCTCTCCTCAGTCCATCACTCCCTCTGTCCCTCACACTGTCCTTCTTTGACATTTCTCCTTTTGTTCATACCTCCAAATTCAAAACCCGAATTCGAAAAACACCAGAAAAATGCTTCATCTTTCCTCCCTCTTTCTGGCTGTAATATTCTGTTTATACCCAATTTTCTGTTATGGAAATGCAGAGGTTAGT...

CDS

Download CDS FASTA

2010 bp · LXL04_026543|LXL04_026543|OH1004|CDS

ATGCTTCATCTTTCCTCCCTCTTTCTGGCTGTAATATTCTGTTTATACCCAATTTTCTGTTATGGAAATGCAGAGGTTAGTGTTCTTATGGAGATCAAGGCTTCCCTGGACCCCGAAAACAAGCACCTTACTTCATGGACGGAAACCGGCGATCCTTGCAGCGGTTCATTTCTCGGTGTCGCTTGTAACCAGTATCTGAAAGTAGCTAACATCTCCTTACAAGGCAAAGGGCTCACCGGAAAACTCTCTCCAGCCATTTC...

Protein

Download Protein FASTA

669 aa · LXL04_026543|LXL04_026543|OH1004|PROTEIN

MLHLSSLFLAVIFCLYPIFCYGNAEVSVLMEIKASLDPENKHLTSWTETGDPCSGSFLGVACNQYLKVANISLQGKGLTGKLSPAISGLKCLSGLYLHYNFLTGEIPAEISSLNELSELYLNVNNLTGEIPQEIGSMTGLQVMELCCNKLTGTIPPELGNLKKLNVVALQHNRLTGQIPRTLGDLAVLERLDLSFNRLLGTIPINIARVTQLEFFDVQNNTLSGFVPTGLKRLNSGFNYNNNQDLCGAAFSSLRPCTDLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026543`
TK1151 ID	TkA06G006310
OH-1004 ID	LXL04_026543
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.913 / OH-1004 68.012 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026543

Location Chr05:127988744-127991556 (-)

Description Similar to IRK: Probable LRR receptor-like serine/threonine-protein kinase IRK

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56370`	Probable LRR receptor-like serine/threonine-protein kinase IRK.	No verified direct reference in this release
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At3g25560`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BB68`	LRR receptor kinase involved in defense response.	No verified direct reference in this release
`Os08g0174700`	LRR receptor kinase involved in defense response.	Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield.2009 · DOI: 10.1111/j.1467-7652.2009.00444.x A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice.2011 · DOI: 10.1007/s10059-011-0178-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026543 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048364 root development Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0090511 periclinal cell division Biological Process

GO:1901653 cellular response to peptide Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G25560

ath:AT3G56370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.857

Rank 1 · LXL04_026543 · OH-1004

Cytoplasm0.084

Rank 2 · LXL04_026543 · OH-1004

Endoplasmic reticulum0.075

Rank 3 · LXL04_026543 · OH-1004

Nucleus0.065

Rank 4 · LXL04_026543 · OH-1004

Lysosome / Vacuole0.022

Rank 5 · LXL04_026543 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_223-63 aa

PF23598.2LRR_1480-171 aa

PF13855.13LRR_8139-198 aa

PF00069.32Pkinase401-662 aa

PF07714.24PK_Tyr_Ser-Thr404-664 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026543	`PF08263.18`	LRRNT_2	23	63	2.5e-08	34.8
LXL04_026543	`PF23598.2`	LRR_14	80	171	3e-12	46.7
LXL04_026543	`PF13855.13`	LRR_8	139	198	8.2e-13	48.6
LXL04_026543	`PF00069.32`	Pkinase	401	662	9e-31	107.9
LXL04_026543	`PF07714.24`	PK_Tyr_Ser-Thr	404	664	1.5e-39	136.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LY03`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase IRK	32.178%	Swiss-Prot	moderate database homology
`Q9SHI2`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	30.317%	Swiss-Prot	moderate database homology
`Q8RY65`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 6	28.333%	Swiss-Prot	weak database homology
`B8BB68`	Oryza sativa subsp. indica	LRR receptor kinase BAK1	31.115%	Swiss-Prot	moderate database homology
`Q6Z4U4`	Oryza sativa subsp. japonica	LRR receptor kinase BAK1	31.115%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card