LXL04_035673 | RubberDandelionOmics

Gene overview

LXL04_035673

Reference: OH-1004 Chr: Chr08 Coordinates: 26839142-26841165 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

912 bp · LXL04_035673|LXL04_035673|OH1004|cDNA

ATGGCAGCCTTCACAAACCTCATCATCAAACCTCAAAATCTTTGCTCCACAACTAAGCTCAACACACCTTTCTCTTGGGGTTACAACCCTAAACTCCAATCATTCTTCCCCACCAAACCCAAGATTTCCCTACCACCACTTTTCATCGCAAAAGCCGCCGCCACCACCTCCAACGTGAAAAACGGAAGCGTGGGTGGTGGAGCTGCCAAGGCCAAGGAGGAGGACAAAGTGCAGCACATCCACACAGTGGCGGAGTTTGA...

CDS

Download CDS FASTA

912 bp · LXL04_035673|LXL04_035673|OH1004|CDS

ATGGCAGCCTTCACAAACCTCATCATCAAACCTCAAAATCTTTGCTCCACAACTAAGCTCAACACACCTTTCTCTTGGGGTTACAACCCTAAACTCCAATCATTCTTCCCCACCAAACCCAAGATTTCCCTACCACCACTTTTCATCGCAAAAGCCGCCGCCACCACCTCCAACGTGAAAAACGGAAGCGTGGGTGGTGGAGCTGCCAAGGCCAAGGAGGAGGACAAAGTGCAGCACATCCACACAGTGGCGGAGTTTGA...

Protein

Download Protein FASTA

303 aa · LXL04_035673|LXL04_035673|OH1004|PROTEIN

MAAFTNLIIKPQNLCSTTKLNTPFSWGYNPKLQSFFPTKPKISLPPLFIAKAAATTSNVKNGSVGGGAAKAKEEDKVQHIHTVAEFEAALREAKQKLVVVEYAASHSKQSSKMYPFMVNLSKTCNDVVFLLVMGDESEETRELCRKEKIDKVPHFSFYKNMEKIHDEEGIGPDMLEGDVLYYGDNHSGVVQLHNREDVEKLIADHKADQKLIVLDVGLKHCGPCVKVYPTVLKLSKQMDNAVFARMNGDENDSCMQFLKD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035673`
TK1151 ID	TkAUNG002070
OH-1004 ID	LXL04_035673
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 71.144 / OH-1004 47.195 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035673

Location Chr08:26839142-26841165 (-)

Description Similar to CDSP32: Thioredoxin-like protein CDSP32, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76080`	Probable thiol-disulfide oxidoreductase involved in resistance to oxidative stress.	Plant thioredoxin CDSP32 regenerates 1-cys methionine sulfoxide reductase B activity through the direct reduction of sulfenic acid.2010 · DOI: 10.1074/jbc.m110.108373
`At1g45145`	Thiol-disulfide oxidoreductase involved in response to pathogens and oxidative stresses.	Thioredoxin h5 is required for victorin sensitivity mediated by a CC-NBS-LRR gene in Arabidopsis.2007 · DOI: 10.1105/tpc.106.047563
`At1g59730`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0476900`	Thiol-disulfide oxidoreductase that may participate in various redox reactions.	Rice NTRC is a high-efficiency redox system for chloroplast protection against oxidative damage.2006 · DOI: 10.1105/tpc.106.041541
`Os07g0190800`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035673 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010188 response to microbial phytotoxin Biological Process

GO:0010286 heat acclimation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G45145

ath:AT1G59730

ath:AT1G76080

dosa:Os07g0190800

dosa:Os07g0476900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.961

Rank 1 · LXL04_035673 · OH-1004

Mitochondrion0.044

Rank 2 · LXL04_035673 · OH-1004

Nucleus0.037

Rank 3 · LXL04_035673 · OH-1004

Cytoplasm0.033

Rank 4 · LXL04_035673 · OH-1004

Cell membrane0.019

Rank 5 · LXL04_035673 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin80-170 aa

PF14595.13Thioredoxin_9194-274 aa

PF00085.27Thioredoxin196-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035673	`PF00085.27`	Thioredoxin	80	170	3.3e-20	72.7
LXL04_035673	`PF14595.13`	Thioredoxin_9	194	274	1.3e-06	29.0
LXL04_035673	`PF00085.27`	Thioredoxin	196	286	3.3e-20	72.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGS4`	Arabidopsis thaliana	Thioredoxin-like protein CDSP32, chloroplastic	64.286%	Swiss-Prot	strong database homology
`Q39241`	Arabidopsis thaliana	Thioredoxin H5	28.829%	Swiss-Prot	weak database homology
`Q9XIF4`	Arabidopsis thaliana	Thioredoxin H7	31.193%	Swiss-Prot	weak database homology
`Q84NN4`	Oryza sativa subsp. japonica	Thioredoxin-like protein CDSP32, chloroplastic	71.861%	Swiss-Prot	strong database homology
`Q6Z4I3`	Oryza sativa subsp. japonica	Thioredoxin H2-1	30.476%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card