TkAUNG002070 | RubberDandelionOmics

Gene overview

TkAUNG002070

Reference: TK1151 Chr: ChrUn Coordinates: 630328-632685 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1248 bp · TkAUNG002070|TK1151|cDNA

AAAAAATCAAAATGAATGGTGGATAGTGGTGGATGAGCTTCAAACTCAACGAGTGTTCCCATAATTCCTGACTTGATTTCAACATCTCATTCCTCCTCTTTTTCAACCCCATCTTCTCCTCTTCCCTCCTACCACCTCCACCACCACCTCATCCATCGCACATCACAACCACCTTCCAATTCTCCGGCCAACAATGGCAGCCTTCACAAACCTCATCATCAAACCTCAAAATCTTTGCTCCACAACTAAGCTCAACACAC...

CDS

Download CDS FASTA

606 bp · TkAUNG002070|TK1151|CDS

ATGGCAGCCTTCACAAACCTCATCATCAAACCTCAAAATCTTTGCTCCACAACTAAGCTCAACACACCTTTCTCTTGGGGTTACAACCCTAAACTCCAATCATTCTTCCCCACCAAACCCAAGATTTCCCTACCACCACTTTTCATCGCAAAAGCCGCCGCCACCACCTCCAACGTGAAAAACGGAAGCGTGGGTGGTGGAGCTGCCAAGGCCAAGGAGGAGGACAAAGTGCAGCACATCCACACAGTGGAAGAGTTTGA...

Protein

Download Protein FASTA

201 aa · TkAUNG002070|TK1151|PROTEIN

MAAFTNLIIKPQNLCSTTKLNTPFSWGYNPKLQSFFPTKPKISLPPLFIAKAAATTSNVKNGSVGGGAAKAKEEDKVQHIHTVEEFEAALREAKQKLVVVEYAASHSKQSSKMYPFMVNLSKTCNDVVFLLVMGDESEETRELLPEGEDRQGALILASTRTWRRSMMKKGLGRICWRVMFCTTVIITPAWCNSITGKMLRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG002070`
TK1151 ID	TkAUNG002070
OH-1004 ID	LXL04_035673
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 71.144 / OH-1004 47.195 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG002070

Location ChrUn:630328-632685 (+)

Description Similar to CDSP32: Thioredoxin-like protein CDSP32, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76080`	Probable thiol-disulfide oxidoreductase involved in resistance to oxidative stress.	Plant thioredoxin CDSP32 regenerates 1-cys methionine sulfoxide reductase B activity through the direct reduction of sulfenic acid.2010 · DOI: 10.1074/jbc.m110.108373

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0476900`	Thiol-disulfide oxidoreductase that may participate in various redox reactions.	Rice NTRC is a high-efficiency redox system for chloroplast protection against oxidative damage.2006 · DOI: 10.1105/tpc.106.041541

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035673 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010188 response to microbial phytotoxin Biological Process

GO:0010286 heat acclimation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G45145

ath:AT1G59730

ath:AT1G76080

dosa:Os07g0190800

dosa:Os07g0476900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.940

Rank 1 · TkAUNG002070 · TK1151

Mitochondrion0.059

Rank 2 · TkAUNG002070 · TK1151

Nucleus0.037

Rank 3 · TkAUNG002070 · TK1151

Cytoplasm0.022

Rank 4 · TkAUNG002070 · TK1151

Cell membrane0.015

Rank 5 · TkAUNG002070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00544Pectate_lyase_452-106 aa

PF00085Thioredoxin80-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG002070	`PF00544`	Pectate_lyase_4	52	106	0.087	12.5
TkAUNG002070	`PF00085`	Thioredoxin	80	139	0.013	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGS4`	Arabidopsis thaliana	sp\|Q9SGS4\|CDSP_ARATH Thioredoxin-like protein CDSP32, chloroplastic	44.900%	Swiss-Prot	Medium
`Q84NN4`	Oryza sativa subsp. japonica	sp\|Q84NN4\|CDSP_ORYSJ Thioredoxin-like protein CDSP32, chloroplastic	62.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card