Gene Card
Gene overview
cDNA / CDS / Protein Sequences
654 bp · LXL04_029932|LXL04_029932|OH1004|cDNA
ATGGAATCCTTCTGTTCGTTCTTGGATGGTTGGAGTTACGAATCTCTCACGAATTTCCGTCCAATCTCTCCCGAAGTTCAGACTTTTCTAAAACAGGAATATGCCCTCCTATATTTGTTCTTAATAGCAGAAGCAATCGGGGTTTACTTTCACATCTTATGGAATATCGGAGGGCTTCTCACCACTTTGGCAGCATTAGGATGCATGTTTTGGTTACATTATTCTCCTCCCGATGAAGAGCTAAAAGGGGTCTTACTAAT...
654 bp · LXL04_029932|LXL04_029932|OH1004|CDS
ATGGAATCCTTCTGTTCGTTCTTGGATGGTTGGAGTTACGAATCTCTCACGAATTTCCGTCCAATCTCTCCCGAAGTTCAGACTTTTCTAAAACAGGAATATGCCCTCCTATATTTGTTCTTAATAGCAGAAGCAATCGGGGTTTACTTTCACATCTTATGGAATATCGGAGGGCTTCTCACCACTTTGGCAGCATTAGGATGCATGTTTTGGTTACATTATTCTCCTCCCGATGAAGAGCTAAAAGGGGTCTTACTAAT...
Protein
Download Protein FASTA217 aa · LXL04_029932|LXL04_029932|OH1004|PROTEIN
MESFCSFLDGWSYESLTNFRPISPEVQTFLKQEYALLYLFLIAEAIGVYFHILWNIGGLLTTLAALGCMFWLHYSPPDEELKGVLLIMACNILKGASFSPIINLAIDFDPSIMLTQLTGAAITLACFSIATMLSRRREYIYLGTLVFSSVLIFFWLDVASKIFGGDIALLQFEFYIVLLVFVGWMVVLTQVEIWNEESLEEEEEEEKLKLATNNNVV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_029932 |
|---|---|
| TK1151 ID | TkA07G360330 |
| OH-1004 ID | LXL04_029932 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.500 |
| Protein coverage (%) | TK1151 99.490 / OH-1004 89.862Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_029932 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:103547620-103549094 (+) | ||||||||||||
| Description | Similar to BI-1: Bax inhibitor 1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000038 very long-chain fatty acid metabolic process Biological Process GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0002638 negative regulation of immunoglobulin production Biological Process GO:0006914 autophagy Biological Process GO:0006983 ER overload response Biological Process GO:0009414 response to water deprivation Biological Process GO:0010523 negative regulation of calcium ion transport into cytosol Biological Process GO:0033119 negative regulation of RNA splicing Biological Process GO:0034620 cellular response to unfolded protein Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0043069 negative regulation of programmed cell death Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT5G47120 dosa:Os02g0125300 hsa:7009 pon:100173088 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01027.27Bax1-I26-193 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_029932 | PF01027.27 | Bax1-I | 26 | 193 | 3.3e-23 | 83.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.