TkA07G360330 | RubberDandelionOmics

Gene overview

TkA07G360330

Reference: TK1151 Chr: Chr07 Coordinates: 90266197-90267487 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA07G360330|TK1151|cDNA

ATGGAATCCTTCTGTTCGTTCTCGGATGGTTGGAGTTACGAATCTCTCACGAATTTCCGTCCAATCTCTCCCGAAGTTCAGACTTTTCTAAAACAGGAATATGCCCTCCTATATTTGTTCTTAATAGCAGAAGCAATCGGGGTTTACTTTCACATCTTATGGAATATCGGAGGGCTTCTCACCACTTTGGCAGCATTAGGATGCATGTTTTGGTTACATTATTCTCCTCCCGATGAAGAGCTAAAAGGGGTCTTACTAAT...

CDS

Download CDS FASTA

591 bp · TkA07G360330|TK1151|CDS

ATGGAATCCTTCTGTTCGTTCTCGGATGGTTGGAGTTACGAATCTCTCACGAATTTCCGTCCAATCTCTCCCGAAGTTCAGACTTTTCTAAAACAGGAATATGCCCTCCTATATTTGTTCTTAATAGCAGAAGCAATCGGGGTTTACTTTCACATCTTATGGAATATCGGAGGGCTTCTCACCACTTTGGCAGCATTAGGATGCATGTTTTGGTTACATTATTCTCCTCCCGATGAAGAGCTAAAAGGGGTCTTACTAAT...

Protein

Download Protein FASTA

196 aa · TkA07G360330|TK1151|PROTEIN

MESFCSFSDGWSYESLTNFRPISPEVQTFLKQEYALLYLFLIAEAIGVYFHILWNIGGLLTTLAALGCMFWLHYSPPDEELKGVLLIMACNILKGASFSPIINLAIDFDPSIMLTQLTGAAITLACFSIATMLSRRREYIYLGTLVFSSVLIFFWLDVASKIFGGDIALLQFEIYIVLLVFVGWMVVLTQVEIWSM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G360330`
TK1151 ID	TkA07G360330
OH-1004 ID	LXL04_029932
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 99.490 / OH-1004 89.862 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G360330

Location Chr07:90266197-90267487 (+)

Description Similar to BI-1: Bax inhibitor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47120`	Suppressor of apoptosis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0125300`	Suppressor of apoptosis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029932 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0002638 negative regulation of immunoglobulin production Biological Process

GO:0006914 autophagy Biological Process

GO:0006983 ER overload response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010523 negative regulation of calcium ion transport into cytosol Biological Process

GO:0033119 negative regulation of RNA splicing Biological Process

GO:0034620 cellular response to unfolded protein Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

KEGG gene cross-reference

ath:AT5G47120

dosa:Os02g0125300

hsa:7009

pon:100173088

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.672

Rank 1 · TkA07G360330 · TK1151

Golgi apparatus0.186

Rank 2 · TkA07G360330 · TK1151

Cytoplasm0.126

Rank 3 · TkA07G360330 · TK1151

Nucleus0.097

Rank 4 · TkA07G360330 · TK1151

Lysosome / Vacuole0.077

Rank 5 · TkA07G360330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01027Bax1-I26-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G360330	`PF01027`	Bax1-I	26	190	3.7e-20	73.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD45`	Arabidopsis thaliana	sp\|Q9LD45\|BI1_ARATH Bax inhibitor 1	51.000%	Swiss-Prot	High
`Q9MBD8`	Oryza sativa subsp. japonica	sp\|Q9MBD8\|BI1_ORYSJ Bax inhibitor 1	46.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card