LXL04_005983 | RubberDandelionOmics

Gene overview

LXL04_005983

Reference: OH-1004 Chr: Chr01 Coordinates: 176623402-176624354 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

615 bp · LXL04_005983|LXL04_005983|OH1004|cDNA

ATGTCAGATTCCCATTCCCATTCCCGTTCCAAATCCATATCCCTACCCCCTCGTCTCTCGTCTTCTCACGAACACCATCGAAAATtcaaaatggtgtgcatacGCAAGGCAACAATGGATGACCTGTTTGCAATGCAGGCCTGCAACCTCTTCTGTCTCCCTGAGAACTACCAAATGAAATACTACTTCTATCACATCCTCTCTTGGCCCCAGCTCCTCCACGTCGCTGAGGATTACGGCGGCAAGATCGTTGGATACGT...

CDS

Download CDS FASTA

615 bp · LXL04_005983|LXL04_005983|OH1004|CDS

ATGTCAGATTCCCATTCCCATTCCCGTTCCAAATCCATATCCCTACCCCCTCGTCTCTCGTCTTCTCACGAACACCATCGAAAATTCAAAATGGTGTGCATACGCAAGGCAACAATGGATGACCTGTTTGCAATGCAGGCCTGCAACCTCTTCTGTCTCCCTGAGAACTACCAAATGAAATACTACTTCTATCACATCCTCTCTTGGCCCCAGCTCCTCCACGTCGCTGAGGATTACGGCGGCAAGATCGTTGGATACGT...

Protein

Download Protein FASTA

204 aa · LXL04_005983|LXL04_005983|OH1004|PROTEIN

MSDSHSHSRSKSISLPPRLSSSHEHHRKFKMVCIRKATMDDLFAMQACNLFCLPENYQMKYYFYHILSWPQLLHVAEDYGGKIVGYVLAKMEEETTECHGHITSLAVLRTHRKLGLATKLMTASQNAMEQVFGAEYVSLHVRKSNRAAFHLYTETLGYKIHDIEAKYYADGEDAYDMRKQLKGKHQHLHHHHAGGCCSGDAKTE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005983`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005983

Location Chr01:176623402-176624354 (-)

Description Similar to NAA10: N-terminal acetyltransferase A complex catalytic subunit NAA10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13780`	Catalytic subunit of the NatA N-alpha-acetyltransferase complex.	Protein N-terminal acetylation is required for embryogenesis in Arabidopsis.2016 · DOI: 10.1093/jxb/erw257 NatA is required for suspensor development in Arabidopsis.2016 · DOI: 10.1080/15592324.2016.1231293

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005983 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006474 N-terminal protein amino acid acetylation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0051604 protein maturation Biological Process

GO:1904592 positive regulation of protein refolding Biological Process

GO:2000719 negative regulation of maintenance of mitotic sister chromatid cohesion, centromeric Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005813 centrosome Cellular Component

KEGG gene cross-reference

ath:AT5G13780

bta:613636

hsa:8260

mmu:56292

mmu:97243

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.579

Rank 1 · LXL04_005983 · OH-1004

Cytoplasm0.575

Rank 2 · LXL04_005983 · OH-1004

Cell membrane0.100

Rank 3 · LXL04_005983 · OH-1004

Mitochondrion0.064

Rank 4 · LXL04_005983 · OH-1004

Endoplasmic reticulum0.040

Rank 5 · LXL04_005983 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583.32Acetyltransf_151-158 aa

PF13673.14Acetyltransf_1073-181 aa

PF13508.14Acetyltransf_773-159 aa

PF08445.17FR4798-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005983	`PF00583.32`	Acetyltransf_1	51	158	1.6e-18	67.8
LXL04_005983	`PF13673.14`	Acetyltransf_10	73	181	1.6e-09	38.5
LXL04_005983	`PF13508.14`	Acetyltransf_7	73	159	1.8e-09	38.6
LXL04_005983	`PF08445.17`	FR47	98	161	7.6e-06	26.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKI4`	Arabidopsis thaliana	N-terminal acetyltransferase A complex catalytic subunit NAA10	83.146%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card