LXL04_005969 | RubberDandelionOmics

Gene overview

LXL04_005969

Reference: OH-1004 Chr: Chr01 Coordinates: 176496236-176499217 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1905 bp · LXL04_005969|LXL04_005969|OH1004|cDNA

ATGGCCATGGCCCTCCACTCTGTGGTTCCAAATTCTGAAAAcatcaccaccaccatcaccgCCGCTCCCGCTAATCAGGACCATGGCCATCAGCACACGGCCTTATACCCTATAACTCTAAAGTTTGAAGACGTCGTTTATAAAGTTAAACTTGAACAAAAAGGTTCAAGAGAGAAGACGATACTAAATGGGGTAACAGGTACGGTTTGTCCAGGAGAGATACTAGCAATGTTGGGTCCATCAGGAAGTGGTAAAACCAC...

CDS

Download CDS FASTA

1905 bp · LXL04_005969|LXL04_005969|OH1004|CDS

ATGGCCATGGCCCTCCACTCTGTGGTTCCAAATTCTGAAAACATCACCACCACCATCACCGCCGCTCCCGCTAATCAGGACCATGGCCATCAGCACACGGCCTTATACCCTATAACTCTAAAGTTTGAAGACGTCGTTTATAAAGTTAAACTTGAACAAAAAGGTTCAAGAGAGAAGACGATACTAAATGGGGTAACAGGTACGGTTTGTCCAGGAGAGATACTAGCAATGTTGGGTCCATCAGGAAGTGGTAAAACCAC...

Protein

Download Protein FASTA

634 aa · LXL04_005969|LXL04_005969|OH1004|PROTEIN

MAMALHSVVPNSENITTTITAAPANQDHGHQHTALYPITLKFEDVVYKVKLEQKGSREKTILNGVTGTVCPGEILAMLGPSGSGKTTLLTALGGRLTGKLSGKITYNSHPFSGPTKRKTGFVTQDDVLYPHLTVNETLLFTAMLRLPKTLTQVEKVHQVARVIAELGLTRCQNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAHRILTMVKRLASGGRTVVTTIHQPSSRIYHMFDKVILLSEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005969`
TK1151 ID	TkA01G003760
OH-1004 ID	LXL04_005969
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005969

Location Chr01:176496236-176499217 (-)

Description Similar to ABCG14: ABC transporter G family member 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31770`	Positive regulator of plant growth which acts as an efflux pump involved in the major root-to-shoot (acropetal) long-distance cytokinin (CK) transport via the xylem sap.	ABCG9, ABCG11 and ABCG14 ABC transporters are required for vascular development in Arabidopsis.2013 · DOI: 10.1111/tpj.12334 Arabidopsis ABCG14 protein controls the acropetal translocation of root-synthesized cytokinins.2014 · DOI: 10.1038/ncomms4274 Arabidopsis ABCG14 is essential for the root-to-shoot translocation of cytokinin.2014 · DOI: 10.1073/pnas.1321519111 Cytokinin Response Factor 6 Represses Cytokinin-Associated Genes during Oxidative Stress.2016 · DOI: 10.1104/pp.16.00415 A Role of Cytokinin Transporter in Arabidopsis Immunity.2017 · DOI: 10.1094/mpmi-01-17-0011-r
`At3g25620`	ABC transporter G family member 21.	No verified direct reference in this release
`At4g27420`	Together with ABCG31, involved in pollen coat deposition of steryl glycosides required for pollen fitness.	ABCG9, ABCG11 and ABCG14 ABC transporters are required for vascular development in Arabidopsis.2013 · DOI: 10.1111/tpj.12334 The role of Arabidopsis ABCG9 and ABCG31 ATP binding cassette transporters in pollen fitness and the deposition of steryl glycosides on the pollen coat.2014 · DOI: 10.1105/tpc.113.118935
`At5g06530`	ABC transporter G family member 22.	No verified direct reference in this release
`At3g52310`	ABC transporter G family member 27.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005969 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0010115 regulation of abscisic acid biosynthetic process Biological Process

GO:0010148 transpiration Biological Process

GO:0010184 cytokinin transport Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010222 stem vascular tissue pattern formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0140115 export across plasma membrane Biological Process

KEGG gene cross-reference

ath:AT1G31770

ath:AT3G25620

ath:AT4G27420

ath:AT5G06530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.636

Rank 1 · LXL04_005969 · OH-1004

Cytoplasm0.154

Rank 2 · LXL04_005969 · OH-1004

Lysosome / Vacuole0.124

Rank 3 · LXL04_005969 · OH-1004

Endoplasmic reticulum0.117

Rank 4 · LXL04_005969 · OH-1004

Golgi apparatus0.075

Rank 5 · LXL04_005969 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005.34ABC_tran62-212 aa

PF13304.13AAA_21202-239 aa

PF19055.7ABC2_membrane_7241-300 aa

PF01061.30ABC2_membrane372-578 aa

PF12698.14ABC2_membrane_3423-626 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005969	`PF00005.34`	ABC_tran	62	212	6.1e-27	95.6
LXL04_005969	`PF13304.13`	AAA_21	202	239	3.8e-08	34.4
LXL04_005969	`PF19055.7`	ABC2_membrane_7	241	300	1.2e-13	51.5
LXL04_005969	`PF01061.30`	ABC2_membrane	372	578	7.6e-44	150.5
LXL04_005969	`PF12698.14`	ABC2_membrane_3	423	626	7.8e-07	29.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6W5`	Arabidopsis thaliana	ABC transporter G family member 14	72.555%	Swiss-Prot	strong database homology
`Q7XA72`	Arabidopsis thaliana	ABC transporter G family member 21	58.766%	Swiss-Prot	strong database homology
`Q9SZR9`	Arabidopsis thaliana	ABC transporter G family member 9	53.409%	Swiss-Prot	strong database homology
`Q93YS4`	Arabidopsis thaliana	ABC transporter G family member 22	49.221%	Swiss-Prot	moderate database homology
`Q9FT51`	Arabidopsis thaliana	ABC transporter G family member 27	48.666%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card