LXL04_005248 | RubberDandelionOmics

Gene overview

LXL04_005248

Reference: OH-1004 Chr: Chr01 Coordinates: 158888329-158892117 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1662 bp · LXL04_005248|LXL04_005248|OH1004|cDNA

ATGGCATCTTTGATTTCAATGTCCATCGTAAAAAACTATGGTTTTCCGCCACGTCAGGAGGTTTCCCGAGATTCTAGGATTTCACCCATATTTGGGATGCCTAGGGTTTCTACAAAGAAAACTAGAACGTTGACTGTGAATGTGGCCACCGATTTGCCAGGGATTCAATCTCCGGTTGAGGACAAAGTGGTAGTAGATGACCGGAAACTAGTGGCATGGAAAAGTGTTCGGCAAGAGCGGTGGGAAGGAGAGCTTGTTGT...

CDS

Download CDS FASTA

1662 bp · LXL04_005248|LXL04_005248|OH1004|CDS

ATGGCATCTTTGATTTCAATGTCCATCGTAAAAAACTATGGTTTTCCGCCACGTCAGGAGGTTTCCCGAGATTCTAGGATTTCACCCATATTTGGGATGCCTAGGGTTTCTACAAAGAAAACTAGAACGTTGACTGTGAATGTGGCCACCGATTTGCCAGGGATTCAATCTCCGGTTGAGGACAAAGTGGTAGTAGATGACCGGAAACTAGTGGCATGGAAAAGTGTTCGGCAAGAGCGGTGGGAAGGAGAGCTTGTTGT...

Protein

Download Protein FASTA

553 aa · LXL04_005248|LXL04_005248|OH1004|PROTEIN

MASLISMSIVKNYGFPPRQEVSRDSRISPIFGMPRVSTKKTRTLTVNVATDLPGIQSPVEDKVVVDDRKLVAWKSVRQERWEGELVVEGEIPKWLSGTYLRNGPGLWHVGDYDFRHLFDGYATLVGLHFNNGHLTMGHRQIESDAYKAAKNSNKLCYREFSETPKHDNFLAYIGDLANLFSGASLTDNANTGVVKLADGRVVCLTETIKGSIVVDPNTLDTLEKFEYTDSLGGLIHSAHPIVTDSEFITLLPDLINPGYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005248`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005248

Location Chr01:158888329-158892117 (+)

Description Similar to CCD8B: Carotenoid cleavage dioxygenase 8 homolog B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32810`	May cleave a CCD7-derived C₂₇ carotenoid derivative in strigolactone biosynthesis.	MAX4 and RMS1 are orthologous dioxygenase-like genes that regulate shoot branching in Arabidopsis and pea.2003 · DOI: 10.1101/gad.256603 The biochemical characterization of two carotenoid cleavage enzymes from Arabidopsis indicates that a carotenoid-derived compound inhibits lateral branching.2004 · DOI: 10.1074/jbc.m409004200 Characterization of three members of the Arabidopsis carotenoid cleavage dioxygenase family demonstrates the divergent roles of this multifunctional enzyme family.2006 · DOI: 10.1111/j.1365-313x.2006.02666.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0746400`	Involved in strigolactones biosynthesis by cleaving the C(27) 9-cis-10'-apo-beta-carotenal produced by CCD7.	No verified direct reference in this release
`Os01g0566500`	May be involved in strigolactones biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005248 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001523 retinoid metabolic process Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009733 response to auxin Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0016121 carotene catabolic process Biological Process

GO:0016124 xanthophyll catabolic process Biological Process

GO:0042572 retinol metabolic process Biological Process

GO:0042574 retinal metabolic process Biological Process

GO:1901601 strigolactone biosynthetic process Biological Process

GO:1901810 beta-carotene metabolic process Biological Process

KEGG gene cross-reference

ag:CAO85888

ath:AT4G32810

dosa:Os01g0566500

dosa:Os01g0746400

mmu:63857

osa:4327933

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · LXL04_005248 · OH-1004

Mitochondrion0.038

Rank 2 · LXL04_005248 · OH-1004

Cytoplasm0.021

Rank 3 · LXL04_005248 · OH-1004

Peroxisome0.019

Rank 4 · LXL04_005248 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_005248 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03055.22RPE6575-551 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005248	`PF03055.22`	RPE65	75	551	1.3e-99	335.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY26`	Arabidopsis thaliana	Carotenoid cleavage dioxygenase 8, chloroplastic	63.774%	Swiss-Prot	strong database homology
`Q8LIY8`	Oryza sativa subsp. japonica	Carotenoid cleavage dioxygenase 8 homolog B, chloroplastic	77.938%	Swiss-Prot	strong database homology
`Q93VD5`	Oryza sativa subsp. japonica	Carotenoid cleavage dioxygenase 8 homolog A, chloroplastic	63.860%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card