LXL04_004935 | RubberDandelionOmics

Gene overview

LXL04_004935

Reference: OH-1004 Chr: Chr01 Coordinates: 150558812-150561216 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · LXL04_004935|LXL04_004935|OH1004|cDNA

ATGAATATTGTGGATGATTTATATGCAAAGTTCATGTTATCCGGGAATAATTACATGAATATGGTGAAACCCTGTTGGAAGCCGTCGGCTGACGGCGATGTACGGAAGACCGGAGATCAAACCGGAAGAACAGACGGATTGCTATGGTACAAAGATTTGGGGTCTCATGTAAGCGGCGAATTCTCGATGGCGGTGATTCAAGCAAACAATTTGTTAGAAGATCAAAGCCAAGTCGAATCAGGACCCTTAAGTTCAATGAG...

CDS

Download CDS FASTA

1185 bp · LXL04_004935|LXL04_004935|OH1004|CDS

ATGAATATTGTGGATGATTTATATGCAAAGTTCATGTTATCCGGGAATAATTACATGAATATGGTGAAACCCTGTTGGAAGCCGTCGGCTGACGGCGATGTACGGAAGACCGGAGATCAAACCGGAAGAACAGACGGATTGCTATGGTACAAAGATTTGGGGTCTCATGTAAGCGGCGAATTCTCGATGGCGGTGATTCAAGCAAACAATTTGTTAGAAGATCAAAGCCAAGTCGAATCAGGACCCTTAAGTTCAATGAG...

Protein

Download Protein FASTA

394 aa · LXL04_004935|LXL04_004935|OH1004|PROTEIN

MNIVDDLYAKFMLSGNNYMNMVKPCWKPSADGDVRKTGDQTGRTDGLLWYKDLGSHVSGEFSMAVIQANNLLEDQSQVESGPLSSMSSGPYGTFIGVYDGHGGPETSRFVNENLFPNLKKFASEDQEMSASVIKRAFLATEDEFLSVVRDQFRICPQIASVGTCCLVGVISNGLVYVANAGDSRVVLGRAERGVRGVSSIQLSTEHNASFASVRDELRSLHPDDPKIVVLKHNVWRVKGLIQVSRSIGDAYLKKAEFNRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004935`
TK1151 ID	TkA01G095430
OH-1004 ID	LXL04_004935
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.700
Protein coverage (%)	TK1151 31.200 / OH-1004 9.645 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004935

Location Chr01:150558812-150561216 (+)

Description Similar to PP2C38: Probable protein phosphatase 2C 38

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12620`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness (By similarity).	The Arabidopsis Protein Phosphatase PP2C38 Negatively Regulates the Central Immune Kinase BIK1.2016 · DOI: 10.1371/journal.ppat.1005811
`At3g55050`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release
`At4g38520`	Dephosphorylates and represses plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release
`At3g51370`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0717800`	Probable protein phosphatase 2C 60.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004935 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G12620

ath:AT3G51370

ath:AT3G55050

ath:AT4G38520

dosa:Os06g0717800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.267

Rank 1 · LXL04_004935 · OH-1004

Cytoplasm0.252

Rank 2 · LXL04_004935 · OH-1004

Nucleus0.243

Rank 3 · LXL04_004935 · OH-1004

Endoplasmic reticulum0.106

Rank 4 · LXL04_004935 · OH-1004

Golgi apparatus0.088

Rank 5 · LXL04_004935 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C83-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004935	`PF00481.27`	PP2C	83	336	8.7e-38	131.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHJ9`	Arabidopsis thaliana	Probable protein phosphatase 2C 38	69.634%	Swiss-Prot	strong database homology
`Q94CL8`	Arabidopsis thaliana	Probable protein phosphatase 2C 48	65.426%	Swiss-Prot	strong database homology
`Q5PNS9`	Arabidopsis thaliana	Probable protein phosphatase 2C 64	64.752%	Swiss-Prot	strong database homology
`Q9SD12`	Arabidopsis thaliana	Probable protein phosphatase 2C 46	69.075%	Swiss-Prot	strong database homology
`Q5Z8P0`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 60	67.460%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card