LXL04_000342 | RubberDandelionOmics

Gene overview

LXL04_000342

Reference: OH-1004 Chr: Chr01 Coordinates: 6402414-6404063 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

939 bp · LXL04_000342|LXL04_000342|OH1004|cDNA

ATGTCTGGATACCCACATAACACATCGGGATACGGTGCTCCACCACCGTCGTCACAACCACACTCCTCCGCCCCTTACGGCGCCCCAGCACAACCTTACGGTGCCCCAGCACAACCCTACGGCGCCCCAGCACAATCCTACGGTGGTGCTCCTGCACAACCCTATGGCGCCCCTGCACAACCCTATGGCGCATCAGGCCATCCTCAACAATCCCCTTATGCCCCCGGAGCCAGTCCATACGGTGCACCACCGGCTTCAGC...

CDS

Download CDS FASTA

939 bp · LXL04_000342|LXL04_000342|OH1004|CDS

ATGTCTGGATACCCACATAACACATCGGGATACGGTGCTCCACCACCGTCGTCACAACCACACTCCTCCGCCCCTTACGGCGCCCCAGCACAACCTTACGGTGCCCCAGCACAACCCTACGGCGCCCCAGCACAATCCTACGGTGGTGCTCCTGCACAACCCTATGGCGCCCCTGCACAACCCTATGGCGCATCAGGCCATCCTCAACAATCCCCTTATGCCCCCGGAGCCAGTCCATACGGTGCACCACCGGCTTCAGC...

Protein

Download Protein FASTA

312 aa · LXL04_000342|LXL04_000342|OH1004|PROTEIN

MSGYPHNTSGYGAPPPSSQPHSSAPYGAPAQPYGAPAQPYGAPAQSYGGAPAQPYGAPAQPYGASGHPQQSPYAPGASPYGAPPASAPYGAHPETKPPKENKPSSSPYGAPQQPGGGYGQAPGGYGSSPFAALLPSTFPPGTDPNVVACFQVADQDGSGIIDDKELQRALSSYNQSFSIRTVHLLMYTFTNTNSRKIGPKEFTQVFYSLQNWRANFEKFDRDRSGKIDMNELREALMSLGFAVSPVVLDLLVSKFDKTGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000342`
TK1151 ID	TkA01G618360
OH-1004 ID	LXL04_000342
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 14.976 / OH-1004 9.936 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000342

Location Chr01:6402414-6404063 (+)

Description Similar to CBP: Calcium-binding protein CBP

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10300`	Potential calcium sensor.	No verified direct reference in this release
`At5g04170`	Potential calcium sensor.	No verified direct reference in this release
`At2g27480`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0137100`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000342 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0048208 COPII vesicle coating Biological Process

GO:1902527 positive regulation of protein monoubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

GO:0031463 Cul3-RING ubiquitin ligase complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0048306 calcium-dependent protein binding Molecular Function

GO:1990756 ubiquitin-like ligase-substrate adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G27480

ath:AT3G10300

ath:AT5G04170

dosa:Os12g0137100

osa:4351450

xla:495978

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.748

Rank 1 · LXL04_000342 · OH-1004

Nucleus0.320

Rank 2 · LXL04_000342 · OH-1004

Cell membrane0.128

Rank 3 · LXL04_000342 · OH-1004

Endoplasmic reticulum0.069

Rank 4 · LXL04_000342 · OH-1004

Extracellular0.053

Rank 5 · LXL04_000342 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13202.13EF-hand_5147-168 aa

PF13499.13EF-hand_7149-206 aa

PF00036.39EF-hand_1149-172 aa

PF13405.13EF-hand_6212-240 aa

PF13499.13EF-hand_7216-272 aa

PF00036.39EF-hand_1216-239 aa

PF13202.13EF-hand_5216-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000342	`PF13202.13`	EF-hand_5	147	168	1.3e-12	47.3
LXL04_000342	`PF13499.13`	EF-hand_7	149	206	3.3e-15	56.9
LXL04_000342	`PF00036.39`	EF-hand_1	149	172	9.7e-14	50.5
LXL04_000342	`PF13405.13`	EF-hand_6	212	240	2.2e-14	52.5
LXL04_000342	`PF13499.13`	EF-hand_7	216	272	3.3e-15	56.9
LXL04_000342	`PF00036.39`	EF-hand_1	216	239	9.7e-14	50.5
LXL04_000342	`PF13202.13`	EF-hand_5	216	236	1.3e-12	47.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4L0`	Arabidopsis thaliana	Probable calcium-binding protein CML49	61.300%	Swiss-Prot	strong database homology
`Q9FYE4`	Arabidopsis thaliana	Probable calcium-binding protein CML50	65.185%	Swiss-Prot	strong database homology
`Q9ZQH1`	Arabidopsis thaliana	Probable calcium-binding protein CML48	42.614%	Swiss-Prot	moderate database homology
`Q2QY10`	Oryza sativa subsp. japonica	Calcium-binding protein CBP	74.704%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card