LXL04_000084 | RubberDandelionOmics

Gene overview

LXL04_000084

Reference: OH-1004 Chr: Chr01 Coordinates: 2020891-2023961 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1881 bp · LXL04_000084|LXL04_000084|OH1004|cDNA

ATGAGAGGGGATAACTTACGGCTTGTAATTTGCATTTGGATTTTGTTTATACATAGATCTTGTTTCTGTAATTTTGTGGTCGAAAAGAATAGTTTGAAGGTGACTTCACCTGAGAGTTTAAGAGGTACATATGAATGCGCAATCGGTAATTTCGGTGTTCCTCGATATGGAGGAAGATTAAGCGGCTTAGTTACATATCCGAAAACTAACCAAAATTCTTGCAAAAACTTCACCGATGATATCCACTTGATTTCAAAGAA...

CDS

Download CDS FASTA

1881 bp · LXL04_000084|LXL04_000084|OH1004|CDS

ATGAGAGGGGATAACTTACGGCTTGTAATTTGCATTTGGATTTTGTTTATACATAGATCTTGTTTCTGTAATTTTGTGGTCGAAAAGAATAGTTTGAAGGTGACTTCACCTGAGAGTTTAAGAGGTACATATGAATGCGCAATCGGTAATTTCGGTGTTCCTCGATATGGAGGAAGATTAAGCGGCTTAGTTACATATCCGAAAACTAACCAAAATTCTTGCAAAAACTTCACCGATGATATCCACTTGATTTCAAAGAA...

Protein

Download Protein FASTA

626 aa · LXL04_000084|LXL04_000084|OH1004|PROTEIN

MRGDNLRLVICIWILFIHRSCFCNFVVEKNSLKVTSPESLRGTYECAIGNFGVPRYGGRLSGLVTYPKTNQNSCKNFTDDIHLISKKPGSIPVFLLADRGECYFTTKAWNAQNTGASAILVADDRPEHLITMDLPEKEETLDYLQNITIPPVLITHSLGVSLKKALESNNLVFVNLDWTEALPHPDDRVEYEFWTNSNDECGPKCDTQIDFVKSFKGFAQLLERKGYTRFTPHYITWFCPEEYVSSTKCKSQCINHGRYC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000084`
TK1151 ID	TkA01G635700
OH-1004 ID	LXL04_000084
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000084

Location Chr01:2020891-2023961 (-)

Description Similar to VSR2: Vacuolar-sorting receptor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30290`	Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.	No verified direct reference in this release
`At3g52850`	Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.	Vacuolar sorting receptor for seed storage proteins in Arabidopsis thaliana.2003 · DOI: 10.1073/pnas.2530568100
`At2g14740`	Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.	No verified direct reference in this release
`At2g14720`	Vacuolar-sorting receptor (VSR) involved in clathrin-coated vesicles sorting from Golgi apparatus to vacuoles.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000084 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0007034 vacuolar transport Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G14720

ath:AT2G14740

ath:AT2G30290

ath:AT3G52850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.382

Rank 1 · LXL04_000084 · OH-1004

Golgi apparatus0.249

Rank 2 · LXL04_000084 · OH-1004

Cytoplasm0.239

Rank 3 · LXL04_000084 · OH-1004

Cell membrane0.212

Rank 4 · LXL04_000084 · OH-1004

Endoplasmic reticulum0.171

Rank 5 · LXL04_000084 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02225.28PA94-161 aa

PF25011.2VSR_TRX189-397 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000084	`PF02225.28`	PA	94	161	1.8e-10	41.5
LXL04_000084	`PF25011.2`	VSR_TRX	189	397	7.6e-100	333.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22925`	Arabidopsis thaliana	Vacuolar-sorting receptor 2	65.528%	Swiss-Prot	strong database homology
`P93026`	Arabidopsis thaliana	Vacuolar-sorting receptor 1	64.238%	Swiss-Prot	strong database homology
`O80977`	Arabidopsis thaliana	Vacuolar-sorting receptor 3	64.034%	Swiss-Prot	strong database homology
`Q56ZQ3`	Arabidopsis thaliana	Vacuolar-sorting receptor 4	63.697%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card